SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017822 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017822
Domain Number 1 Region: 376-501
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000127
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 312-350
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000779
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 3 Region: 280-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000383
Family EGF-type module 0.0079
Further Details:      
 
Domain Number 4 Region: 353-387
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000168
Family EGF-type module 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000017822
Domain Number - Region: 240-279
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0208
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017822   Gene: ENSGACG00000013482   Transcript: ENSGACT00000017857
Sequence length 685
Comment pep:known_by_projection group:BROADS1:groupI:18256028:18272665:1 gene:ENSGACG00000013482 transcript:ENSGACT00000017857 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARSLLPCLLLFVSAQTIFSSAVFELKINSFTSARSVCQFQTQDCQIFFRVCLKHSQDSQ
DDTKPEPPCTYGIAFTEIFGADPKSISASAPVKVDISFKWPETFALIIEAWNAESSGLDS
TENQNNLISRLATRHRLRVGEDWSQGVQFGNQSELNYSYHLVCNEYYHGNACSSYCRPRN
DTFGHYTCDDNGGRRCLGGWTGVYCSHPICAAGCSKDHGLCESPGECVCRQGWQGERCDE
CARHPGCIHGTCLQPWQCNCREGWGGLYCDQDLNYCTNHKPCKNDASCTNTGQGSYTCTC
RPGFTSKNCEIETNECDSNPCKNGGSCKDLENDYSCECPQGFYGKNCEISAMTCADGPCF
NGGTCTESVVGGYSCRCPSGYTGSNCEKRIDKCSSNPCANGAQCLDLGKRIMCRCRAGFT
GSRCETNIDDCASNPCFNAGTCVDGINDFTCTCTLGFTSKDCAMRISSCDHPCHNGGACY
THFTGPVCKCPLGFMGARCEYPVPMATTKPSGNPDGPSALIAAVALGLVTLTLLVFAAIH
ILRQLRRGRKLTGMTTSVKNNLETANNRNTLVSGGGSYNGSLPGAPLCSLREKEAFLIPG
GQLKVSNKDAALVENGGDNNAIFKNQMADCNLARDEQRMARNKFDPKKCDSSVIVPPLSF
SKDGLYHPVFIIPEEMEHCVFATEV
Download sequence
Identical sequences G3PJP2
ENSGACP00000017822 ENSGACP00000017822 69293.ENSGACP00000017822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]