SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018101 from Gasterosteus aculeatus 76_1

(show help)
Strong hits

Sequence:	ENSGACP00000018101
Domain Number 1	Region: 28-137
Classification Level	Classification	E-value
Superfamily	Spermadhesin, CUB domain	5.23e-20
Family	Spermadhesin, CUB domain	0.0016
Further Details:

Domain Number 2	Region: 156-219
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.000000000132
Family	Complement control module/SCR domain	0.002
Further Details:

Domain Number 3	Region: 217-259
Classification Level	Classification	E-value
Superfamily	Spermadhesin, CUB domain	0.00000000183
Family	Spermadhesin, CUB domain	0.0028
Further Details:

Weak hits

Sequence:	ENSGACP00000018101
Domain Number -	Region: 2-32
Classification Level	Classification	E-value
Superfamily	Complement control module/SCR domain	0.0386
Family	Complement control module/SCR domain	0.0075
Further Details:

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

External link(s)	Protein: ENSGACP00000018101 Gene: ENSGACG00000013701 Transcript: ENSGACT00000018136
Sequence length	261
Comment	pep:known_by_projection group:BROADS1:groupI:19812109:19819985:1 gene:ENSGACG00000013701 transcript:ENSGACT00000018136 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	LQGSSVRTCLNASTPYWSGKESHCLAACGGLISNITVGRIVSPGFPSNYSNNLTCHWLLE APEGQRIHIHFEKVALAEDDDRLLIKNGNNFDAAALYDSYKVEYLPNEGLLSMSRHLFAE MTTDATGTSTGIAIRYQGKIMLSIYIYVIAFAAGHCYEPFVKYGNLTSSDHTWAVGAVVE FACDTGYTLEQGSITIECIDSNNPQWNETEPACRAVCSGEVTDSAGLVLSPNWPEAYEKG QDCIWGIHVEEDKRIMVDIQV
Download sequence
Identical sequences	G3PKH1 ENSGACP00000018101 69293.ENSGACP00000018101 ENSGACP00000018101

SEARCH