SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018139 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018139
Domain Number 1 Region: 88-415
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 4.28e-53
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.000000634
Further Details:      
 
Domain Number 2 Region: 419-550
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.23e-17
Family Ricin B-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018139   Gene: ENSGACG00000013724   Transcript: ENSGACT00000018174
Sequence length 555
Comment pep:known_by_projection group:BROADS1:groupXIX:18819140:18825480:-1 gene:ENSGACG00000013724 transcript:ENSGACT00000018174 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEEDRAGQRAAAEVKKLSVEKQPEQPDSKIQEQPKPPEEKKSNKLFPNSALFKAWGENL
PEDVQTEAQSLYMKYGYNVYLSDRLPVDRALPDTRDKRCLKKIYPKDLPTLGVVLIYLNE
ALSVIQRAVRSIVDRTPKHLLKEIILVDDNSSNDDLKEDLDAYIKTTEQQNPSLRIARVR
HSEQRGLAHARASGWEAATADVVAILDAHIEVHEQWAEPLLTQIKGDRTVVTSPVFDRIN
FDDLKVTEYQPASHAFDWALWCMYEGFSDDYYKLQDGSLPGKSPSVMGIMVADRKYLGEI
GVIDKGMKVYGGENVELGIRVWTCGGSIEVVPCSRIAHIERAHKPYMPDLSQAMKRNALR
VAEIWMDEYKHNVNLAWNLPFENHGIDIGDVSERKKLRETLKCKPFKWYLENVYPKLDPW
DNIVAYGVLKNLDADMCLDQGPVPGNTPIAYGCHYYEPQFTYYRSNGELYIGGIKSHKYN
DNRCVADPGKKDTEPGLYNCKEAMQKGMGIYWDLTQGKEMKNRDSKKCLEIKKGKLLIQE
CSGQRWEIQNIIKPF
Download sequence
Identical sequences G3PKK9
ENSGACP00000018139 ENSGACP00000018139 69293.ENSGACP00000018139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]