SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018168 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018168
Domain Number 1 Region: 706-920
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.67e-77
Family Fibrinogen C-terminal domain-like 0.00000283
Further Details:      
 
Domain Number 2 Region: 439-599
Classification Level Classification E-value
Superfamily Fibronectin type III 2.42e-22
Family Fibronectin type III 0.00077
Further Details:      
 
Domain Number 3 Region: 260-437
Classification Level Classification E-value
Superfamily Fibronectin type III 5.55e-18
Family Fibronectin type III 0.0013
Further Details:      
 
Domain Number 4 Region: 612-702
Classification Level Classification E-value
Superfamily Fibronectin type III 1.69e-16
Family Fibronectin type III 0.00079
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000018168
Domain Number - Region: 134-256
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000251
Family Growth factor receptor domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018168   Gene: ENSGACG00000013750   Transcript: ENSGACT00000018203
Sequence length 937
Comment pep:known_by_projection group:BROADS1:groupIII:1926879:1948283:-1 gene:ENSGACG00000013750 transcript:ENSGACT00000018203 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVRLLWRVLCPLVLLCTVSPLSSASNHPDPSAPQQGGTFSNVYKIDIPGSSGCKLELLP
NQDETGLQTETTMSGENSITFQHNIRLQTPKCDCEESESFKSLLYRVNGLEEEVNYLKTQ
CTQGCCGSGGAAGVDTSCSGHGAYQPDACSCLCNPGWEGPDCSVSSCPDECNDNGRCVNG
KCVCQQGFTGDDCSQQTCPDNCNDKGQCVDGRCVCFPHFSGEACGVQRCPKDCVGNGLCV
DGQCICKEGFYGVDCSSVHSPQGLRLVQKTDVSLLVNWETVRGAEYYILRYHPKKAKTTA
SKVRVSNTENSHLITGLAAGVTYIVQVHAVIKDIQSEADKIEATTEVSAIDGIRVLGQTD
VSIHLDWKNPSAEVDHFRLTHTDPSGQEEEQNVLRNQEARTRHTIVGLFPGTEYQITVQA
MKGTTEGKPSSVTAATDIDAPVNLIPKKVTEDTATLSWDRVQAEIDGYMLSYTSSEGSSE
EIKVGSDTTSYMLSGLRPGVLYTVYLWAIKGSRASRKSSTQAETALDAPANLSARDESES
SFSVSWDPAHAEIDGYVLTYGSSEGYSGETPVGPEKTSYTLTSLRPGAFYTVHIWAVKGN
KASKKISTQAQTDIDSPKKLKATDVTLESAFLTWVPPLADIDGYILTYRDEDGNMEMVKK
QLGAHESSYALSGLEMSKRYVATIVAYKGNKRSKVVETTFRTVGILYPFPMDCTQIMKNG
NKKSGIYTVYINNDDSQPIEAYCDMETDGGGWLVLQRRHSGKLDFMKRWRQYIAGFGNMT
DEFWIGLDKIYKLTNTSTQYELRFDLGLGAERAYAVYDSFKIAPVKQNFRITIGTYSGTA
GDAMTYHQDQAWTTVDKDNDVTMSNCALNHHGAWWYKNCHLANINGKWGDTRHSVGVNWK
PWKGHLVSLDFTEMKIRAVGARSGRRSRSLADRKKSR
Download sequence
Identical sequences G3PKN8
ENSGACP00000018168 69293.ENSGACP00000018168 ENSGACP00000018168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]