SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018218 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018218
Domain Number 1 Region: 239-295
Classification Level Classification E-value
Superfamily BPTI-like 1.35e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0027
Further Details:      
 
Domain Number 2 Region: 371-428
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0037
Further Details:      
 
Domain Number 3 Region: 319-357
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000995
Family LDL receptor-like module 0.0021
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000018218
Domain Number - Region: 150-236
Classification Level Classification E-value
Superfamily PKD domain 0.000961
Family PKD domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018218   Gene: ENSGACG00000013791   Transcript: ENSGACT00000018253
Sequence length 499
Comment pep:known_by_projection group:BROADS1:groupXVIII:16209762:16213711:1 gene:ENSGACG00000013791 transcript:ENSGACT00000018253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPSSSSSSIAPLFLLVVVARLSGAEDASCSAAFRSGPEDFVLDAEAAVKAGAALLSSA
RVRSAEACRSACCGMPLCDLALLQPRGGGAEAAEHRECVLFNCVHRNRFVCRFVNHKGFL
SYIRASVFQVYLRGPQATGDDALPIAIAPRDVIIQPGEVVTLSGIQSLPIGDAHISRYQW
SLVSGDVNVTMERTDLPDQVRLSNLQSGSFVFQLTVIDSNDQRSRAANVSVVVLDPERSR
TFCLSPLKVGPCRAAFPRWSYNATTSACKPFLFGGCKSNSNNFLSEEECVSACRGVSAVH
HKYKAGVNVYLCVAECGSTCGPAQLTCDSGCCLDRSLECDEVTQCRDGADEEHCGKLNQT
FHRLLDIDVNQKKARCAEPPLTGPCRANLTHWYYDPLNRKCFHFTWGGCDGNENNFEDED
KCRETCDGVTGTHELTHSRGMFDRFGAEEDESESGNIALAVCLSVAILALLAVLTYCFLK
SRKERSHRPVATGPAHVAL
Download sequence
Identical sequences G3PKT8
ENSGACP00000018218 ENSGACP00000018218 69293.ENSGACP00000018218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]