SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018265 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018265
Domain Number 1 Region: 356-470
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 1.11e-17
Family Mannose 6-phosphate receptor domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000018265
Domain Number - Region: 46-76
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000236
Family LDL receptor-like module 0.0051
Further Details:      
 
Domain Number - Region: 78-117
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000916
Family LDL receptor-like module 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018265   Gene: ENSGACG00000013828   Transcript: ENSGACT00000018300
Sequence length 486
Comment pep:known_by_projection group:BROADS1:groupXI:13568757:13573909:1 gene:ENSGACG00000013828 transcript:ENSGACT00000018300 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YISIFFFYFTVRYCKYILCSFGAVLALTRFFCSTSSERQFYEEGKPFTCLDGSRTIPFDR
VNDDYCDCQDGSDEPGTAACPNGSFHCTNAGFKPGFIPSSRINDGICDCCDTTDEYNSGA
TCQNTCRELGRKERESMQKMAEVAKEGFLLKQQLIQESKRGLEEKKAKHADIDLGKKELE
NKVEALRTVKEAAEEPEKEAKERHLKAWEGLRRHCWEERTKWIMQRLSPFGVTSKHQANA
DPPAPVETPLEEIRETDSDHESEQYPEEDIDTDDREVKPPSSSVKLALDDSRVVLVSHRC
LFRSLRRRRAKKRRMAMMRGRCRPTTQTRRASLMVSACMEVSDSQSSALRNLEKEISFDF
GPSAEFAYLYSQCYELTTSEYIYRLCPFNRVSQKPKFGGSETNLGSWGQWAGPEDNIYSV
MKYDHGTGCWQGPNRSTTIKLTCGKETVLTSTSEPSRCEYLMEFITPAVCQEPRSLDSDH
HEHVEL
Download sequence
Identical sequences G3PKY5
ENSGACP00000018265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]