SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018274 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018274
Domain Number 1 Region: 389-511
Classification Level Classification E-value
Superfamily Mannose 6-phosphate receptor domain 3.53e-18
Family Mannose 6-phosphate receptor domain 0.008
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000018274
Domain Number - Region: 40-70
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000262
Family LDL receptor-like module 0.0051
Further Details:      
 
Domain Number - Region: 214-281
Classification Level Classification E-value
Superfamily EF-hand 0.000622
Family Eps15 homology domain (EH domain) 0.061
Further Details:      
 
Domain Number - Region: 72-111
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00179
Family LDL receptor-like module 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018274   Gene: ENSGACG00000013828   Transcript: ENSGACT00000018310
Sequence length 527
Comment pep:known_by_projection group:BROADS1:groupXI:13569552:13573986:1 gene:ENSGACG00000013828 transcript:ENSGACT00000018310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTCQHLLLFLLLAVGVSAVEVQRPRGVPLSKRQFYEEGKPFTCLDGSRTIPFDRVNDDYC
DCQDGSDEPGTAACPNGSFHCTNAGFKPGFIPSSRINDGICDCCDTTDEYNSGATCQNTC
RELGRKERESMQKMAEVAKEGFLLKQQLIQESKRGLEEKKAKHADIDLGKKELENKVEAL
RTVKEAAEEPEKEAKERHLKAWEEQKAVIQMEKDKAKMAEVFLELDDDADGFVSVAELLS
HSELDSDLGDSFTEAEAQKALLGGADQVDHAAFESVWSNIKGKYVSEHQANADPPAPVET
PLEEIRETDSDHESEQYPEEDIHDDTDDRESPLSVQVPPTAQSQEKKDGDDEGTMPPYDP
DTQSLIDAAQKARDAFDEAEKALREVDDQIKNLEKEISFDFGPSAEFAYLYSQCYELTTS
EYIYRLCPFNRVSQKPKFGGSETNLGSWGQWAGPEDNIYSVMKYDHGTGCWQGPNRSTTI
KLTCGKETVLTSTSEPSRCEYLMEFITPAVCQEPRSLDSDHHEHVEL
Download sequence
Identical sequences G3PKZ4
ENSGACP00000018274

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]