SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018302 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000018302
Domain Number - Region: 8-43
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00399
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018302   Gene: ENSGACG00000013858   Transcript: ENSGACT00000018337
Sequence length 380
Comment pep:known_by_projection group:BROADS1:groupXIX:19599780:19602358:-1 gene:ENSGACG00000013858 transcript:ENSGACT00000018337 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQCVRGVCSVEHCTNSTRCLLSEDQRRCKCANGYYSDQCDKNAHIKVVCGKDFIAIRAM
EDYFTFHSVPLQSLHLPNKSCRPQREVIDGVPYFVSKISKDEYQMCGGKALTRKNQISYS
LSLQSEPQVIGNIVRNPVIKMNYTCVYPSIRTVSLPFPVIHFSSELVMHLDELDANIQMM
LYTDQSYSKAYSSAPTIGLRDKVYVEVKVTEPADYFLLRLNECWATQFPQPNATAGLVYT
LLLNGCVDDETVSFLKSAGESGGNGESSTIHYSFDMFRFTAEPHDLYLHCTVELCTPEEH
NSCTPNCNSMSKREAMRSDPSLGLLSYGPIRIEMPDRHQSSILATVVLPVAGVWILGFFI
IILITVIKAGNRRFKLTGEQ
Download sequence
Identical sequences G3PL22
69293.ENSGACP00000018302 ENSGACP00000018302 ENSGACP00000018302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]