SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018316 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018316
Domain Number 1 Region: 307-650
Classification Level Classification E-value
Superfamily DNase I-like 4.03e-76
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.00000128
Further Details:      
 
Domain Number 2 Region: 808-972
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-31
Family BCR-homology GTPase activation domain (BH-domain) 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018316   Gene: ENSGACG00000013866   Transcript: ENSGACT00000018351
Sequence length 976
Comment pep:known_by_projection group:BROADS1:groupXX:17717428:17731718:1 gene:ENSGACG00000013866 transcript:ENSGACT00000018351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQSVAIQETLQREENCLVAVQCDVFFDNITESRLLGLVESTKEHAIFIYTHRRMAITAE
DVSLEDIVPISLDFAVVEGSPVSVRRIEGADTKVRVSYQERALELRLPFGSHSRFFLSEV
NRAWSGMSAFTNARHVFSFSSVETPREQGRMPGSRQTGARSQRRNAHETQPAEEDRFPRT
PSCCYILLTGGSSSKENFLLTSRRDDSGAVKGARALTSPDVYDRPRMEVKTHAKRSSEVQ
SGVEPLISSRAAKSGPSEKERGANAGAPTSKQTGQVKSSREDRDDLVRSSSHTTSNKAQI
LAMPQFGLRDNIIRCELLKTEDLYTYTEDFSFFLGTYNVNGQTPKESLRPWLSCTANPPD
MYCVGFQELDLSKEAFFFNDTPKELEWTKAVAEALHPDAKYALVKLVRLVGIMLIFYIKK
EHAEFISDVEAESVGTGIMGRMGNKGAVAVRFRFHNSDICVVNSHLAAHIEEYERRNQDY
KDICSRLLFRQLDPTQPPLTIMKHDVIVWIGDLNYRITELDVTTVKELISQKDFETLHGH
DQLKRQMDEEAVFVGFVEGPIDFQPTYKYDTGSDKWDTSEKCRVPAWCDRILWRGKNIAQ
QQYQSHMTLKTSDHKPVSSLLVIGIKKVNAEIYKKTFEDIVRNIDKLENECIPSVTLSNR
EFHFKDVKYMQHQSVTLSLSNDGQVPCQFEFIQKPNEHTYCKPWLTANPPKGFIAQDGSV
DIELEVFVNRSTAPKLNCGKEKMEDILVLHLERGKDYFISVMGNYLPSCYGSSIHSLCQL
REPIQDMPQETLRRVQAENSQTDDETNTEKPLDIPKELWMMVDHLFRNALNQEDIFQQPG
LRIEFAEIRDCLDTGIPDSLPGSNHSAAEALLLFLDALPEPVVPYSFYQQCLENCSSASQ
CEKIISMLPQCHKNVFNYLAAFLRELLKNSASNRLDVSILATIFASLLLKSPTKQDLAEK
RRSQEFFQHFLTQGSS
Download sequence
Identical sequences G3PL36
69293.ENSGACP00000018316 ENSGACP00000018316 ENSGACP00000018316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]