SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018457 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018457
Domain Number 1 Region: 1863-2109
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.59e-54
Family Ankyrin repeat 0.000000054
Further Details:      
 
Domain Number 2 Region: 431-563
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000144
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 848-979
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000148
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 621-749
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000251
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 5 Region: 1162-1304
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000345
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 6 Region: 403-443
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000154
Family EGF-type module 0.00073
Further Details:      
 
Domain Number 7 Region: 746-786
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000255
Family EGF-type module 0.0055
Further Details:      
 
Domain Number 8 Region: 595-633
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000062
Family EGF-type module 0.014
Further Details:      
 
Domain Number 9 Region: 783-820
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000111
Family EGF-type module 0.0091
Further Details:      
 
Domain Number 10 Region: 1013-1050
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000196
Family EGF-type module 0.0033
Further Details:      
 
Domain Number 11 Region: 169-208
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000679
Family EGF-type module 0.0046
Further Details:      
 
Domain Number 12 Region: 976-1018
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000822
Family EGF-type module 0.0093
Further Details:      
 
Domain Number 13 Region: 1038-1180
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000942
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 14 Region: 133-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000162
Family EGF-type module 0.0072
Further Details:      
 
Domain Number 15 Region: 287-325
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000661
Family EGF-type module 0.0051
Further Details:      
 
Domain Number 16 Region: 1300-1345
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000857
Family EGF-type module 0.011
Further Details:      
 
Domain Number 17 Region: 823-860
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000118
Family EGF-type module 0.014
Further Details:      
 
Domain Number 18 Region: 557-600
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000121
Family EGF-type module 0.01
Further Details:      
 
Domain Number 19 Region: 249-296
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.012
Further Details:      
 
Domain Number 20 Region: 96-132
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000239
Family EGF-type module 0.011
Further Details:      
 
Domain Number 21 Region: 211-253
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000396
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 22 Region: 1381-1419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000107
Family EGF-type module 0.022
Further Details:      
 
Domain Number 23 Region: 324-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000161
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 24 Region: 1481-1514
Classification Level Classification E-value
Superfamily Notch domain 0.000000392
Family Notch domain 0.0051
Further Details:      
 
Domain Number 25 Region: 1521-1553
Classification Level Classification E-value
Superfamily Notch domain 0.000000575
Family Notch domain 0.0036
Further Details:      
 
Domain Number 26 Region: 366-408
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000153
Family EGF-type module 0.028
Further Details:      
 
Domain Number 27 Region: 1337-1378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000278
Family EGF-type module 0.015
Further Details:      
 
Domain Number 28 Region: 53-92
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000324
Family EGF-type module 0.017
Further Details:      
 
Domain Number 29 Region: 1441-1472
Classification Level Classification E-value
Superfamily Notch domain 0.0000183
Family Notch domain 0.00069
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000018457
Domain Number - Region: 17-51
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00199
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018457   Gene: ENSGACG00000013973   Transcript: ENSGACT00000018493
Sequence length 2478
Comment pep:known_by_projection group:BROADS1:groupXIII:17562120:17593351:1 gene:ENSGACG00000013973 transcript:ENSGACT00000018493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPPLPFPTKCPSAGLRCSTPTESCLNQGRCEATGNAECRCRDGYVGSSCQFRDPCASSPC
TNGGSCRAVSKGNAVDFNCTCKLGFTDRRCLTPLNNVCVSSPCRNGGTCELESLETYKCR
CPPGWSGKLCQQADPCASNPCANGGQCSAIDSQYICTCAPSFSGKSCKQDVNECDASPSP
CRNGGACVNEFGGFRCQCPQEYTGKYCESRYLPCNPSPCHNGGTCIQKGETSYECSCVPG
FTGKNCNHNIDDCPGHECQNGGTCVDGVNTYNCQCKPEFTGQLCTEDVDECQLMPNACQN
GGTCHNTYGSYQCVCVNGWTGDDCSENIDDCASAACHQGSTCHDRVASFYCECPHGRTGL
LCQLDDACISNPCQKGSNCDTNPVSGNHFCTCPSGYIGASCDQDVDECSLGSNPCEHAGK
CINTKGSFQCKCQRGYVGPRCELDINECISNPCMNEATCLDQIGDFHCICMPGYEGEFCE
VDTDECAHSPCLNNGNCIDKINAFHCQCPTGFTGNVCQIDVDECASTPCKNGAKCTDGPN
KYTCECTEGYSGRHCETDVNECYSDPCHYGTCIDGLASFSCRCRAGYTGRLCETNINECL
SQPCRNGGTCQDRENAYVCSCPQGTTGINCEINIDDCKSNPCDYGTCIDKINGYECACEP
GYTGPMCNINIDECAINPCHNGGTCIDGVNGFTCACPDGYQDPTCFSQVNECLSNPCIHG
HCEDKINGYNCLCDSGWSGKNCDINNNECESNPCMNGGTCKDMTSGYVCTCRAGFTGPNC
QTNINECASNPCLNQGTCIDDVAGYKCNCILPYTGENCETLMAPCSSKPCKHGGVCQESE
DYQSFSCVCPEGWQGQTCEVDIKECVKNPCRNGATCQNTLGSYRCACKPGFAGRNCESNI
DDCKPNPCSNGGLCQDEVNGFLCTCLAGFRGTKCEEDINECESNPCKNGANCTDCVNSYT
CTCPPGFSGIHCENNTPDCTESSCFNGGSCMDGINTFTCLCPPGFTGSYCQHDINECDSR
PCLNGGTCHDSYGTYKCTCPHGYNGLNCQNLVRWCDSSPCKNRGTCWQRDTTYSCECETG
WTGLYCDVPSVSCEVAAKQRGVDVARLCRNSGQCLDAGNVHYCHCQVGYTGSYCEEQVDE
CTPNPCQNGATCTDFLGGYTCKCAPGYVGTNCSDDINECFSQPCQNGGTCIDLINTYKCS
CPRGTQGVHCEINIDDCNPFTDPVTKEPKCFNKGKCVDRVGGYHCICSAGYVGERCEGDI
NECLSNPCDPRGTHSCIQLTNNYRCDCRTGYAGQRCDTVFDGCKGKPCRNGGTCAVASNT
PNGFICKCPPGFTGSTCEYDAQACGSLNCRNGGTCISGHKSPKCLCTPSFTGPECQYPTD
SPCNSNPCYNGGVCEYTSEAPYYHCVCPAVFNGLRCHILDYSFKGGFGHDIPPPSGVEVT
CDIPLCEEAKHNKYCDVLCNNHACGWDNGDCSLNFDDPWKNCSAALQCWRYFNDGKCDSQ
CDNAGCLYDGFDCQNLEGQCNPLYDQYCKDHYADDHCDQGCNNAECEWDGLDCANNMPEK
LALGQLVLVVHIAPELLVNNSFGFLRELSRVLRTNVMFRKEATGGLMVYPYYGSEHELKK
YNVKRSVDSWAEVPGGVLDVVKRSLLDVAGGSRRKKRELDLLQIKGSVVHLEVDNRQCFQ
QSTECFQSTNDAAAFLGALASSGKLDVPYTIEAVYSGVDPQPSQELYPIYLVLGGVGMLA
FLGVGMVAARKRRHEHGRLWLPDGFKTTETSKKKRREPVGEDSVGLKPLKNPSDISLMDD
THNEWGEDEPSDAKRFRFDEQAILEVDDQTDHRQWTQQHLDAADLRIPSIAPTPPQGEIE
NDCMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDASANVINDFIYQGANLHNQTDRT
GETALHLAARYARSDAAKRLLEASADANVQDNMGRTPLHAAVAADAQGVFQILIRNRATD
LDARMHDGTTPLILAARLAVEGMVEELINCHADVNAIDDFGKSALHWAAAVNNVEAVIVL
LKNSANKDMQNNKEETPLFLAAREGSYETAKVLLDHYANREITDHMDRLPRDIAQERMHH
DIVRLMDDYNLVRSPHMHGGSLGTTLSPPLCSPNGYLGGMKQPQPQGQGKKARKPTAKGI
GCKEGKDMKVKKKNSQDGKPGNLLDGSGVLSPVDSLESPHGYVSDVASPPMMTSPFQQSP
SVALNHLQGMSDPHLSVNHMVMPNKQELARMQFDPLPPRLTHLPVSGSGGPGAINGQCDW
LSRMHGNMSQPGQFNPMRGAPGGQGGLHPGGQHGMMTSLHNGHPASLSQMMTYQGIQSTR
LGPQPHIRQDSSTTSGQSFIGGELSSPELQQGGGNSSMPIHTILPQETQIMPTAVSQSMA
STQFLTPPSQHSYSGPMDNTPNHQVQVPDHPFLTPSPGSPDQWSSSSPHSNMSDWSEGIS
SPPTSMQAQIAHLPEQFK
Download sequence
Identical sequences G3PLH6
ENSGACP00000018457 ENSGACP00000018457 69293.ENSGACP00000018457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]