SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018490 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018490
Domain Number 1 Region: 571-853
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.19e-83
Family Protein kinases, catalytic subunit 0.000000000344
Further Details:      
 
Domain Number 2 Region: 1-154
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.89e-69
Family Ephrin receptor ligand binding domain 0.00000025
Further Details:      
 
Domain Number 3 Region: 281-486
Classification Level Classification E-value
Superfamily Fibronectin type III 2.2e-39
Family Fibronectin type III 0.00000672
Further Details:      
 
Domain Number 4 Region: 211-281,319-336
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000113
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 5 Region: 838-886
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000172
Family SAM (sterile alpha motif) domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018490   Gene: ENSGACG00000013951   Transcript: ENSGACT00000018526
Sequence length 890
Comment pep:known_by_projection group:BROADS1:groupIII:2505057:2573131:1 gene:ENSGACG00000013951 transcript:ENSGACT00000018526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WEEVSGYDENLNTIRTYQVCNVFEPSQNNWLLTTFIDRRGAQRIYVEIRFTVRDCSSIPN
VPGSCKETFNLYYYETDAVIATKGTAFWMEAPYLKVDTIAADESFSQVDFGGRLMKVNTE
VRSFGPLSKNGFYLAFQDYGACMSLLSVRVFYKKCPSVVQNFAIFPETMTGAESTSLVIA
RGVCIPNSEEVDVPIKLYCNGDGEWMVPIGSCTCKAGFEPDNGNVCRACPPGTFKSTQGP
GLCLQCPPNSRSTAEAATICVCRNGYYRGDGDQPDEPCTSVPSSPRNVISIVNETSVILE
WHSPRETGGREDVVYNIVCKKCRADRRSCSHCDDNVDFVPRQLGLTDTRVFISNLWAHTL
YSFEIQAVNGVSNRSPYPSQHVSIDITTNQAAPSIVPIMHQISSTMNSFTLSWPQPEQPN
GIILDYELRYYEKDHAEINSTILRSQTNTARVEGLRPGTVYVVQVRARTVAGFGKYSSKM
CFQTLTDDDFKSELREQLPLIAGSAAAGVVFIVSLVAISIVCSRKRAYTKEAVYSDKLQH
YSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSTVKIEEVIGAGEFGEVYKGRLKLP
GKREIYVAIKTLKAGYAEKQRRDFLAEASIMGQFDHPNIIRLEGVVTKSRPVMIVTEFME
NGALDSFLRQNDGQFTVIQLVGMMRGISAGMKYLSEMNYVHRDLAARNILVNSNLVCKVS
DFGLSRYLQDDTSDPSYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFG
ERPYWDMSNQDVINAIEQDYRLPPPMDCPSALHQLMLDCWQKDRNVRPRFSDIVSTLDKM
IRNPTSLKAVANIPAVDLLRIGVTLAGHQKKILSNIQTMRVQMSQSPTTM
Download sequence
Identical sequences G3PLK9
ENSGACP00000018490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]