SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018611 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018611
Domain Number 1 Region: 435-659
Classification Level Classification E-value
Superfamily GFP-like 1.46e-79
Family Domain G2 of nidogen-1 0.00000081
Further Details:      
 
Domain Number 2 Region: 951-1206
Classification Level Classification E-value
Superfamily YWTD domain 8.5e-40
Family YWTD domain 0.000000232
Further Details:      
 
Domain Number 3 Region: 828-926
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 5.36e-20
Family Thyroglobulin type-1 domain 0.00079
Further Details:      
 
Domain Number 4 Region: 805-848
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000124
Family EGF-type module 0.0074
Further Details:      
 
Domain Number 5 Region: 387-432,678-753
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000135
Family Growth factor receptor domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018611   Gene: ENSGACG00000014091   Transcript: ENSGACT00000018647
Sequence length 1216
Comment pep:known_by_projection group:BROADS1:groupI:20844310:20873790:-1 gene:ENSGACG00000014091 transcript:ENSGACT00000018647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERLGMLAACLLCWSCGVCLVSAIRRTDMYPYGPQSGDQVLAEGDDETSRVLPLSRPLTF
YRTRFSQLYVATNGIISAQDLPMEKQYVDDGFPTDFPAVAPFLADIDTSGGRGQIYYRVT
ETPGVLNRVAQEVHQGFPDAKFTPTVAVVATWENVAAYEEQTRTTGPSSKVNTFQAVIGY
DETDSYVIFLYPEGGLNFFGTRPKESYNVEIELPARVGFSRGEIPYLIFSRIEGPHYSVT
SNEQSVKNLYQVGNTGIPGVWLFHTGNSYYFDNIVPASFSGLLDTPPAGGLSLTDGDPEF
QTGPTGDHSASPDAPSSPSEEPSRQAVYDIGNVPLTSEPKYNSEPGERQYAPPNSPERAP
VGGAQQQPQQVLEKRQSEESSVCVLIQYTTENKETCARFQQECSQNAFCSDYATGFCCHC
RPGFYGNGRHCLPEGAPQRVSGKVNGTVTVGSTPVELNNIDLHAYIVVGDGRAYTAISEV
PEPVGWALMPLAPIGELFGWLFALELPNSQAGFKITGAEFTRHAEAIFYPGNQRLSIVQT
GHGIDNHNHLNVDTVVSGSVPFLPSGSEVTMDPFKEIYQYYPSVATSYSVREFSVVSAER
GSESFSFQLKQNITYRDCRHDNRAGVPETLQITMERVFVMYVKEERILRYAITNKISPVG
AEPTEPELVNPCYAGNHDCDTTAQCLPQQGQDFLCQCATGYRGDGRNCYDVDECAEGSSS
CGAHAQCVNLPGSHSCQCQGGFEFGFDRRSCVVEKNRILVNFRELCLFIDYCKSKYKTFS
LFNFGGPAHLCFCYVGCCACGMFSLDIDECSSSPCHISARCINALGSFQCQCEPGFYGDG
FHCSQQEDEPERPKTHCEHHRDRVQTSSPEGYPVVGAYVPQCDAGGQYTPLQCHGSTGHC
WCVDSRGQERTGTRTPPGAPPTDCDKPAAPPTVRPLPRPDVTPPPNADITLLYAQGQKIG
ALPLNGTRLDAARSKTLLTLHGSIVVGIAHDCKENHVYWTDLSARTINRASMAAGAEPEI
LINTNLVSPEGLAVDAKRRLMFWVDSNPDVIESANLDGSGRRTLFSTDLVNPRAIIVVSS
TGTLYWTDWNREAPKIESASVDGQNRRVVVTDGVGLPNALTYDSSSGQVCWADAGTKRLE
CVSPDGSGRRVVHPSLNYPFSMVYYGNHFYYTDWRRDGVIAVSKESSQITDEYLPDQRSH
LYGIAIATTHCLSGSH
Download sequence
Identical sequences G3PLY0
ENSGACP00000018611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]