SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018675 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018675
Domain Number 1 Region: 17-134
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.000000000000675
Family Cysteine rich domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018675   Gene: ENSGACG00000014148   Transcript: ENSGACT00000018713
Sequence length 287
Comment pep:known group:BROADS1:groupII:555934:560524:1 gene:ENSGACG00000014148 transcript:ENSGACT00000018713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFGAWIILFPLLLGARAFMIHNTQSSLCLAESSATGEVLLKKCNVDSESQQWIWIDRSK
LMCVGSSRCLSALQSQLLGTRPCLGSEVDATGLLWDCDRGRLVSRNTSTLLSADGWRLVL
THDSKLSKWKSLDVGDICQEKLRSKRASDDLEEFEATEQQTGKAAAMTDEQREYFRWYYR
TEDPTTWTFVLLGLAFVCLLIGFLLLGMGTMASKNRKKIAMYKAAAAVSVKGEALRIISV
LRDDSSKPSLERLMTGNNGEVSELKAGNIMVTWKDGNTSCLYSDPTA
Download sequence
Identical sequences G3PM44
ENSGACP00000018675 ENSGACP00000018675 69293.ENSGACP00000018675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]