SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018886 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018886
Domain Number 1 Region: 399-416,520-623
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000345
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 2 Region: 952-989,1024-1067
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000386
Family Fibronectin type III 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018886   Gene: ENSGACG00000014303   Transcript: ENSGACT00000018924
Sequence length 1214
Comment pep:known_by_projection group:BROADS1:groupIII:3571387:3812973:1 gene:ENSGACG00000014303 transcript:ENSGACT00000018924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EISGNSEDIPLVRWRQQWLENGTLLFHIHHQDGSLSLPEPTGDPANNSNKEELRILHISV
MGGMIALLLSILCLVLILYTRRRWCKRRRIPQPQKSASAEAANEIHYIPSVLMGGQARES
LRNSRGQGPNSSGTLSIRETPILDGYKYEYDITDLRHHLQRECMNGGEEFASQVTRTLDS
LQGCNDKNSMDLTPVSDNTKLALMNKYKDNIIATSPIDSNHQQNTLLPHNTSTNQRKRLS
SNTRAGSTFLNPDGDSGTEADSEPQLAFYTDPNRSRRRSRAGSPRSPINKTTLTLISVIS
CVIGLVYSSHMSCNLSVRVILHVPEHLIADAGSRFILLQGSQLDASDWLNPAQILLYYQQ
NASGLWVGELCGRRLLDPCEHQCDPETAGDRKTEIPGECLCLDGYMKDPVHKHLCIRSEW
GPNQGPWPYTIFQRGFDLVMGEQPSDRIFRFTYTLGEGMWLPLSKSFVIPPAELAINPSA
KCKTDMTVMEDAVDVREELMVSSSFDSLEVLLDSFGPVRDCTKDNGGCSRNFRCISDRKL
DSTGCMCPPGLSPMKDGTGCYDHHIGIDCSDGFNGGCEQLCLQQLAPLEDDPTLYNIQMF
CGCIEDYKRGADGRSCLPLSEACTEGIDCAEAVDIPANQTVFGDLFYGYNNHSKESTSGQ
ILKATFRQKNFARGIEQQLPDGMVVASVPTEVQCHEELSDPVPDPEYLTGMVNYSEVSGY
PLVQHWSLRSVLYHVKLNQWVLSQAFSSAIHSLDGATQRSDFVSILREFGNHYVQEAMYG
FQESCTIWYPNKQVQRQLWLEYQDISKGNSPSEESEERDKEPRTLTYPAYIASLLDTGAK
RMAAGVRMDCNSQGQCPRSCHLCHMSPRVVQGRQRSEPVLLQITKAAPIYELVSNNETYQ
SLQEAMMSMLWCSGKGDVIDDWCRCDSSAFGSDGLPTCAPLPQPKLKLSYTYEPSSSLVI
MEWNHTEPPIGVRIVDYLISQEKVTERTDHSKVETETLLSFVDDILSGARSPCVMLGDIP
NLLSSSISMIIRCLEPDATYMFRLWAVDNTGRRSNPSEVTIKTPCPTVDDVKAQEIADKI
YNLFNGYTSGKEQQTAYNTLMDLGAPTLHRVLYHYNQRYESFGEFTWRCEDELGPRKAGL
ILSQLNDLSPWCKGLLQEQKIGLRRMSLKFLSCRYTDTRAFGLNWSNMGQDVHKACDEQT
LTVMYNDYGEPKEL
Download sequence
Identical sequences G3PMQ3
ENSGACP00000018886 69293.ENSGACP00000018886 ENSGACP00000018886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]