SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019396 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019396
Domain Number 1 Region: 52-90
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000235
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019396   Gene: ENSGACG00000014688   Transcript: ENSGACT00000019434
Sequence length 237
Comment pep:novel group:BROADS1:groupII:4369941:4372125:-1 gene:ENSGACG00000014688 transcript:ENSGACT00000019434 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WTCVQRRPASSSALITLGEWCTCYPGYRFDRDRHRNHKSPYCLGHDECEHPGNGVCDHEC
VNTVGSFLCRCHSGYILAPDQRSCIPVHNLSSSGKSDTLMSAGTCSFTCEDFINMKNSLL
QLKLRLANTQSPNQVPDLANSSDKPSLGRAGLPGPPGAPGVPGNDSSPGHPGEPGKRGGP
GDRGPPGSRGDMGPMGPEPDLKHVKRGRRGPVGPTGATGRDGLKGDRGAPGPIGPPV
Download sequence
Identical sequences G3PP63
69293.ENSGACP00000019396 ENSGACP00000019396 ENSGACP00000019396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]