SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019511 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019511
Domain Number 1 Region: 88-317,365-412
Classification Level Classification E-value
Superfamily MFS general substrate transporter 7.46e-48
Family LacY-like proton/sugar symporter 0.022
Further Details:      
 
Domain Number 2 Region: 531-673
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.79e-17
Family Glycerol-3-phosphate transporter 0.034
Further Details:      
 
Domain Number 3 Region: 436-515
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 0.000000000144
Family Pentapeptide repeats 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019511   Gene: ENSGACG00000014764   Transcript: ENSGACT00000019549
Sequence length 677
Comment pep:known_by_projection group:BROADS1:groupII:4617301:4628451:-1 gene:ENSGACG00000014764 transcript:ENSGACT00000019549 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEYTYTQDGGGQDGYPYQADYPAQDEDARSDATEGADEDEQMYEGEYQGVPHPDEIKEAR
RAARMEARRKARQAAQQEDEEENLPEQYETIMEDCGHGRFQWMLFFVLGLALMADGVDGF
VVGFVLPSAEKDMCISNSDKGLLGLLVYVAMMVGALVWGGLSDKMGRRKCLIYVLTIDLI
FSFLSCFAQSYGFFLFFRFCSGFGIGGSIPIVYTYYTEFLQMDKRGEHLSWLCMFWMLGG
LYASFTAWGIIPHYGWGFAIGSELQIHSWRLFILVCLFPALAALVGVVFMPESPRFLLES
ARHDEAWMILRRVHDTNWKAKGEPERVFTATNIKTPQTEEDEFIEIQSDTGTAFQRWTVR
HVTMLQQVMANIMSLSAPEFRLQGLFLVIVWFCLAFSYHGLGVWFPDMIKYMQYEEYESK
VKVFHRERVERFHFNFSLVNQIHREGEYIHDKFAEIEIKSVKFEDSLFENCYFEDVRSTN
TFFENCTIKNTVFYNTDLWQEKFKDCRMENTTFLHPKKGCHLNFQEENDIVIYMVSFLGS
LAVLPGNIISALFMDKIGRIRIIGGSMLASSACTFLLLLSFSQGAVICWQCLFYGTSVAA
WNGLEVISVELYPSSKRGTAFGILNGICKLAAILASSIFAAFIGITKIVPIFLAFIALVC
GGLVALKLPETREKILS
Download sequence
Identical sequences G3PPH7
ENSGACP00000019511 69293.ENSGACP00000019511 ENSGACP00000019511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]