SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Gasterosteus aculeatus 76_1 > ENSGACP00000019651

Domain assignment for ENSGACP00000019651 from Gasterosteus aculeatus 76_1

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSGACP00000019651
Domain Number 1	Region: 12-118
Classification Level	Classification	E-value
Superfamily	Spermadhesin, CUB domain	5.36e-27
Family	Spermadhesin, CUB domain	0.0011
Further Details:

Domain Number 2	Region: 212-328
Classification Level	Classification	E-value
Superfamily	Spermadhesin, CUB domain	0.000000000000641
Family	Spermadhesin, CUB domain	0.0032
Further Details:

Domain Number 3	Region: 407-444
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000000628
Family	LDL receptor-like module	0.00085
Further Details:

Domain Number 4	Region: 126-162
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000000746
Family	LDL receptor-like module	0.001
Further Details:

Domain Number 5	Region: 172-211
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000301
Family	LDL receptor-like module	0.0018
Further Details:

Domain Number 6	Region: 368-406
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000131
Family	LDL receptor-like module	0.0018
Further Details:

Domain Number 7	Region: 326-366
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.00000113
Family	LDL receptor-like module	0.0027
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Cellular Component	IC (bits)	H-Score

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSGACP00000019651 Gene: ENSGACG00000014887 Transcript: ENSGACT00000019689
Sequence length	599
Comment	pep:known_by_projection group:BROADS1:groupII:5393864:5396867:-1 gene:ENSGACG00000014887 transcript:ENSGACT00000019689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	APPPPAGCSERAEVHTERRGVIYSPSWPLNYPARVNCSWHIQGGQGEVITISFRNFDVAE SASCSGDFLLLTPTRNGESRLCGSTLPPPFISTRGRVWLYFHSRANSSGQAQGFRLSYIR GHLGQSSCQSDEFLCGNGKCLPRSWKCNSQDECGDGTDERGCSPPPTEARPGLCPLGSLP CTEAQSTRCLPAALRCNGARDCADGTDELGCPDTACGRRLGNFYGSFASPDFFRANRSAA AELRCSWSLDTQDPKPIVLQLDLQLGPGDSLRVYDGLQQRAEHLLQVLSYHNNRRPALLE SSRGQMSVLYTAQPRSPGHGFNATYQVKGYCFPGERPCGSDQGCYSERQRCDGYWHCPSG RDEEACPACPDGEFPCEGGAGACYPASERCNNQKRCPDGSDEKNCYDCQPGNFHCGTNLC IFETWRCDGQEDCLDGSDERDCLAAVPRKVITAALIGSLVCSLLLVIALGCALKLHSLRS REYRAFETQMTRMEAEFVQREAPPSYGQLIAQGLIPPVDDFPVYNPTQASVLQNLRLAMR RQIRRHSTRRSTSSTSSSSSSSSRRRLGHLWSRLLHGAARARGQVPLLDSPGPAQIALG
Download sequence
Identical sequences	G3PPW6 ENSGACP00000019651 ENSGACP00000019651 69293.ENSGACP00000019651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]