SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019651 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019651
Domain Number 1 Region: 12-118
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.36e-27
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 2 Region: 212-328
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000641
Family Spermadhesin, CUB domain 0.0032
Further Details:      
 
Domain Number 3 Region: 407-444
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000628
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 126-162
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000746
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 5 Region: 172-211
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000301
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 6 Region: 368-406
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000131
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 7 Region: 326-366
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000113
Family LDL receptor-like module 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019651   Gene: ENSGACG00000014887   Transcript: ENSGACT00000019689
Sequence length 599
Comment pep:known_by_projection group:BROADS1:groupII:5393864:5396867:-1 gene:ENSGACG00000014887 transcript:ENSGACT00000019689 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APPPPAGCSERAEVHTERRGVIYSPSWPLNYPARVNCSWHIQGGQGEVITISFRNFDVAE
SASCSGDFLLLTPTRNGESRLCGSTLPPPFISTRGRVWLYFHSRANSSGQAQGFRLSYIR
GHLGQSSCQSDEFLCGNGKCLPRSWKCNSQDECGDGTDERGCSPPPTEARPGLCPLGSLP
CTEAQSTRCLPAALRCNGARDCADGTDELGCPDTACGRRLGNFYGSFASPDFFRANRSAA
AELRCSWSLDTQDPKPIVLQLDLQLGPGDSLRVYDGLQQRAEHLLQVLSYHNNRRPALLE
SSRGQMSVLYTAQPRSPGHGFNATYQVKGYCFPGERPCGSDQGCYSERQRCDGYWHCPSG
RDEEACPACPDGEFPCEGGAGACYPASERCNNQKRCPDGSDEKNCYDCQPGNFHCGTNLC
IFETWRCDGQEDCLDGSDERDCLAAVPRKVITAALIGSLVCSLLLVIALGCALKLHSLRS
REYRAFETQMTRMEAEFVQREAPPSYGQLIAQGLIPPVDDFPVYNPTQASVLQNLRLAMR
RQIRRHSTRRSTSSTSSSSSSSSRRRLGHLWSRLLHGAARARGQVPLLDSPGPAQIALG
Download sequence
Identical sequences G3PPW6
ENSGACP00000019651 69293.ENSGACP00000019651 ENSGACP00000019651

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]