SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019665 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019665
Domain Number 1 Region: 45-160
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 5.89e-32
Family Spermadhesin, CUB domain 0.00027
Further Details:      
 
Domain Number 2 Region: 176-300
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-20
Family Spermadhesin, CUB domain 0.0034
Further Details:      
 
Domain Number 3 Region: 298-334
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000982
Family LDL receptor-like module 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019665   Gene: ENSGACG00000014900   Transcript: ENSGACT00000019703
Sequence length 537
Comment pep:known_by_projection group:BROADS1:groupII:5411995:5424118:-1 gene:ENSGACG00000014900 transcript:ENSGACT00000019703 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLLRQLKAALTRLITLTVMEEAFALAQRTKDSPGEHGGQSPSQNDCGTWVRNINGGVFTS
PNYPTTYPPNKECVYILEALPRQRIQLAFDKNYYIEPSFECRFDHIEIRDGPFGFSPLID
RFCGGKNPGLVTSTGRFMWIKFTSDEELEGLGFRIKYTFIADPDFHLHVGGLLNPIPDCQ
FEIGGSDGIIRSSQVEEEEKVKPGDALDCIWTIRAPPHSKIYLRFMEYQMEHSNECQKNF
VAVYDGSSSIENLKAKFCSTVANDVMLNSGVGVVRMWADEKSRLGRFRMLFTSFVDPPCS
GNSFFCHSNMCINNSLVCNGVQNCVYPWDENHCKEKRSEGLFHQITKTHGTVIGVSSGIV
LILLIISILVQMKQPRKKVVVRRPGGFNKAGFQEVFDPPHYELFSLRDKEMSSDLADLSE
ELDSYHKLRRSSTMSRCVHEHHCGSQASVATGGGSMKHSRTTLSSMELSYHNDFSKPPPM
KTFNSTSSYKKSCYGYKQHAQTHDCDQQVIEDRVTEEIPCEIYGRVDPQQRSMSMDF
Download sequence
Identical sequences G3PPY0
ENSGACP00000019665 69293.ENSGACP00000019665 ENSGACP00000019665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]