SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020284 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020284
Domain Number 1 Region: 2-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.76e-70
Family Ephrin receptor ligand binding domain 0.00000155
Further Details:      
 
Domain Number 2 Region: 608-885
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.33e-51
Family Protein kinases, catalytic subunit 0.0000000349
Further Details:      
 
Domain Number 3 Region: 298-508
Classification Level Classification E-value
Superfamily Fibronectin type III 2.92e-39
Family Fibronectin type III 0.00017
Further Details:      
 
Domain Number 4 Region: 905-964
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000334
Family SAM (sterile alpha motif) domain 0.0036
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020284
Domain Number - Region: 228-289
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000269
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020284   Gene: ENSGACG00000015381   Transcript: ENSGACT00000020323
Sequence length 979
Comment pep:novel group:BROADS1:groupIII:7730160:7749741:-1 gene:ENSGACG00000015381 transcript:ENSGACT00000020323 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTLLDTRTVPGELKWAASPSEGGWEEVSIMDEKNIPIRTYQVCNVLEPNQNNWLRTDWIP
RSGAQRVYVEVKFTLRDCNSLPGVTGTCKETFNLYYHESNEDRESYIKESSFIKVDTVAA
DESFTQVDVGDRIMKLNTEVRDVKVATRKGFYLAFQDVGACIALVSVRVFYKTCPLTIRN
LATFPDTVTGADTSSLVEVRGSCVNRSEEREEPKMYCGADGEWLVPIGGCFCSPGYQEKG
GTCKACSVGFYKAKSPDAGCSKCPPHSHSLRDGATVCDCHSAFFRADSDPPSMACTQPPS
APQQLISVVNETSVVLEWAPPRRLGGRSDTSYSLECLICPTASRSHTGLCLPCSSDVVFS
PDQAGLKTTRVVVSELRAHTHYTFIVHARNGVSRASGAGAAQSVSVTVTTNQAAPSAVSS
ILAIDVTRHSLALSWQQPDRPNGVILEYEVKFYEKDQKERSYRIMRTFSRSVDVTGLNPL
TVYVFHVRARTAAGYGEFSPPFESATSSDPFPLIGEGVNTAFLLLSVSGVGILLLISAAV
FIISRRCSIQTCFYTNTLVSLPSLNRRSKYSKTKQDSEEEKHLNPGVKIYVDPFTYEDPD
QAIHEFAKEIDVSSIHIERVIGMVGEFGEVCSGRLRVQGKREIYVAIKSLKAGYSDKQRR
DFLSEASIMGQFDHPNIIRLEGVVTRCKPLMIITEYMENGSLDAFLRRTAHKPSTDDLHT
ILVAFPSINEVLLDEKMKHTELQAADYCHVAFSCQFTYLPNLSRYLDHYEATGTYLSPGG
KIPIRWTAPEAIAYRKFTTASDVWSYGIVMWEVVSYGERPYWDMNNQDVIKAIEEGYRLP
APMDCPVVLHQLMLDCWERERAERPTFSQILNMLDKLIRNPGTLRRTGVGSEVRVSVLPE
VCVPAGSVCEWLRSLGLERYRDTLAAAGYTSIDTLLALTHQEMDRLGIITPSHQDLLIAS
VQQEVLSQMRHMQHTMVPV
Download sequence
Identical sequences G3PRP8
69293.ENSGACP00000020284 ENSGACP00000020284 ENSGACP00000020284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]