SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020287 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020287
Domain Number 1 Region: 625-921
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.37e-81
Family Protein kinases, catalytic subunit 0.00000000329
Further Details:      
 
Domain Number 2 Region: 32-204
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.8e-70
Family Ephrin receptor ligand binding domain 0.00000196
Further Details:      
 
Domain Number 3 Region: 330-536
Classification Level Classification E-value
Superfamily Fibronectin type III 8e-28
Family Fibronectin type III 0.00035
Further Details:      
 
Domain Number 4 Region: 917-990
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.19e-20
Family SAM (sterile alpha motif) domain 0.00036
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020287
Domain Number - Region: 259-321
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000384
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020287   Gene: ENSGACG00000015384   Transcript: ENSGACT00000020326
Sequence length 995
Comment pep:known_by_projection group:BROADS1:groupII:8148242:8183150:-1 gene:ENSGACG00000015384 transcript:ENSGACT00000020326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGLCWKMAYLFYLCYTRSQPSTLLLEYPQPNMVLLDTTTVLGELDWKTYPVNGWDAITEM
DEQNRPIHTFQVCHVMEPNQNNWLRSGWIQRQAAQRVYVELRFTLRDCNSIPWVSGTCKE
TFNLFYLQTEEPLSAATRFRPTDYAKVDTIAADESFTQTDLGDRVLRLNTEVREVGPVTR
RGFYLAFQDVGACIALVSVKVFYKRCPSTVRNLAVFPDTVPHTDSSSLVEVRGACVENAE
ERDTPKLYCGADGDWLVPLGRCVCSIGHAEMDGDCRACKPGSFKAYSGNTECSKCPSHSS
SHDQAATICHCDKGFYRAIKDSSTVACTRPPSAPRNLVSLINDTALFLQWTPPIDTGGRE
DITYNVLCQRCDGRDGDSGVTQCEPCEPDLRFIPRPLSLTATSVAILDFATHVNYTFHVE
AANGVSGLGVSPRSLANVTVNTNQAVKMIKKDWASQNSIALSWPEAEKLPSEIVDYEVKY
FEKEQEQLSYSSTRTKNPSVVVTGLRPSTVYVFHVRVRTAAGYTAYSPNYEFATAAEEEM
KYISDQGQVLVVVTASVGGFSLLVILTLFLLITGRCQGYIKARMKSEEKRRTRFRAGHVP
FSGIKTYVDPDTYEDPTQAVEEFAKEIDPSYICIERVIGAGEFGEVCSGRLHIPGRMDIA
VAIKTLKGGYVEQQRRDFLREASIMGQFDNPNIIRLEGVVTRSRPVMIVVEYMENGALDS
FLRARDGQFTVLQLVGMMRGIAVGMTYLSDMGYIHRDLAARNILVDENLVCKVSDFGMSR
VLEDDTEAAYTATGGKIPIRWTAPEAIAYGKFSSVSDVWSYGIVMWEVMSYGERPYWEMS
NQDVILSIDEGYRLPAPMGCPVTLHQLMLHCWQKESNQRPRFNTVLSFLDKLIINPSSLL
TLVNDLQSYPDSPDDMPDYPLFISIGDWLDSIKMSQYKNNFLAAGYTTLDSISTMSLDDI
RRIGICLIGHQRRILSSIQSLRLQLHHIQQSGFQV
Download sequence
Identical sequences G3PRQ1
69293.ENSGACP00000020287 ENSGACP00000020287 ENSGACP00000020287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]