SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020294 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020294
Domain Number 1 Region: 617-905
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-82
Family Protein kinases, catalytic subunit 0.00000000106
Further Details:      
 
Domain Number 2 Region: 36-206
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.1e-40
Family Ephrin receptor ligand binding domain 0.0000249
Further Details:      
 
Domain Number 3 Region: 332-530
Classification Level Classification E-value
Superfamily Fibronectin type III 1.12e-35
Family Fibronectin type III 0.00011
Further Details:      
 
Domain Number 4 Region: 903-974
Classification Level Classification E-value
Superfamily SAM/Pointed domain 4.12e-20
Family SAM (sterile alpha motif) domain 0.00038
Further Details:      
 
Domain Number 5 Region: 262-331,369-388
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000247
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020294   Gene: ENSGACG00000015386   Transcript: ENSGACT00000020333
Sequence length 980
Comment pep:known_by_projection group:BROADS1:groupIII:7784960:7850927:1 gene:ENSGACG00000015386 transcript:ENSGACT00000020333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PRILWIYPSLHLLSCLVLIFHGLTPCRAVRNYPENEVTLLDSMSALADLGWEAYPNEGGE
GGGLLKATEKMQTFPLCPSEDSLMQKTFRRRHIMRSGLSRAAIDITFDKLHARWCVHIPN
GTAETFNMYYYESNNANLWFIKESQYVKIDTIAADESFTQVDVGDRVMKLNTEVRDISNL
SKKGFYLAFQDLGACIALVSVRVFYKKCPLTVLNLAQFPDTITGGDTALVEVRGVCVNAS
EEFEAPKMYCSADGGWLVPIGRCVCKPGFEENKDGCQPCRPGTYKASATDAYCTKCPPHS
SSPQEQAFECVCERGFYRAETDPRSMACTRSPSAPENPISTVNETCITLEWSPPRDTGGR
GDVTYSLHCRKCSGDSRKCTPCGSSIHFVPRQFGLSSPTVLVTDLQPDSNYSFTVESQNG
VSDLSPTPKGTVVINVTTSQTVSVVLKERRSKDSVTLAWQGPERPDGAIVEYEVIYYEKN
QREQNYTVLKTRSNMMTVEGLKPGTTYVFRVRARTDGGYGTYGGEIELETSHEDVFPIGD
PNQSTILAVSIAGGIVLLVFLVTCFVVSGRHCGYIKAKQDPDEEKMQFQHGRVKLPGSRI
YIHPHTYEDPNQAVRDFAKEIDASNIRIERVIGAGEFGEVCSGRLRVQGKREIYVAIKSL
KAGYSDKQRKDFLSEASIMGQFDHPNIIRLEGVVTKCKPVMIITEFMENGSLDTFLKKHD
GQFTVIQLVGMLRGIASGMKYLSDMSYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDP
EAAYTTRGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVISYGERPYWEMSNQDVIK
AIDEGYRLPAPMDCPVVLHQLMLDCWEKGRSDRPKFGQIVTILDKLIRNPASLRELANSS
AWEDPSTPELSVNTVDEWLEAIKMGQYKENFSSAGYVSLDSILYISVSELAKMGVTLAGH
QKKILSSVENLQSQGTHVQV
Download sequence
Identical sequences G3PRQ8
ENSGACP00000020294 69293.ENSGACP00000020294 ENSGACP00000020294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]