SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020424 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020424
Domain Number 1 Region: 216-456
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.18e-79
Family Eukaryotic proteases 0.00000244
Further Details:      
 
Domain Number 2 Region: 38-101
Classification Level Classification E-value
Superfamily GLA-domain 7.23e-25
Family GLA-domain 0.00018
Further Details:      
 
Domain Number 3 Region: 127-171
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000203
Family EGF-type module 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020424   Gene: ENSGACG00000015474   Transcript: ENSGACT00000020463
Sequence length 473
Comment pep:known_by_projection group:BROADS1:groupI:27519218:27524787:1 gene:ENSGACG00000015474 transcript:ENSGACT00000020463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFWFDQTSSVLLLLHLSAAHAIFLDGEAANQVLTRWRRANSFLEELKQGNLERECMEEAC
NHEEAREIFEDEAKTKEFWNKYFDGDACESTPCANQGVCTDAIGTYTCYCQAGYQGFNCE
IVIPELCENKNGGCEHFCKVERGNIHCSCADGYYLGSDDKSCDSNEPFRCGTVVTKSTRT
VFRLKDTGSNVTTTAASLPNDYVLPDGAIFEDMVVPDMADMTRIVNGENCPPGQCPWQAL
LLDEENVGFCGGTILTNYIILTAAHCMNKSRYIYVKLGEFDVLVDDGNEATHTVETLITH
SMYRKDTYNNDIALIKLATPIKFSRFILPACLPDPVFAEKVLMRQEDGMVSGFGRLGERQ
ETSTILQRLTMPYVDRNTCLQSTQLRISPRMFCAGYDTIAKDACQGDSGGPHVTRYSDTY
FVTGIVSWGEGCAKKGKYGVYTQVSKYISWIRQGIDGLMQKESIVPRPSGPPG
Download sequence
Identical sequences G3PS38
ENSGACP00000020424

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]