SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020671 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020671
Domain Number 1 Region: 278-405
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.67e-19
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 2 Region: 3-131
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-16
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 240-283
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000192
Family EGF-type module 0.02
Further Details:      
 
Domain Number 4 Region: 360-403,454-561
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000127
Family Growth factor receptor domain 0.0069
Further Details:      
 
Domain Number 5 Region: 130-277
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000173
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 6 Region: 635-682
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000458
Family Spermadhesin, CUB domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000020671
Domain Number - Region: 578-635
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00576
Family Growth factor receptor domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020671   Gene: ENSGACG00000015663   Transcript: ENSGACT00000020710
Sequence length 758
Comment pep:known_by_projection group:BROADS1:groupII:10044350:10059165:-1 gene:ENSGACG00000015663 transcript:ENSGACT00000020710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DPCEEGSDGCHIDAICQTTQGSYKCSCKAGYKGDGKHCEDIDECDLEYNGGCVHECNNIP
GNYRCTCYDGFNLAHDGHNCLDVDECKFNNGGCQHTCVNTMGSYECRCKEGFFLSDNQHT
CIHRSVEGLNCMNKEHGCTHICKETPKGGVACECRPGFELARNQRGCILTCNHGNGGCQH
TCEDTENGPICRCHVRYNLQPDKRSCVERDEATTESAEHNATFFTEVDKRVKRRLLMETC
TSNNGGCDCTCKDTSTGVRCSCPVGFTLQPDGKTCKDIDECEPHNGGCEHSCRNTIGSFE
CNCRKGFKLLTDERSCQDIDECFFERTCGHTCVNSPGGFQCLCNKGYTMYGLAHCGDINE
CSVNNGGCEQGCENTVGGFDCVCRPGYKLHWNKKDCIDSCDLNCVRRRSEKRLRKTIRTL
RKSINREQFHLHFAGSDYELAKGLGKPAGLPGHCAAGQVLVGRKCVSCSVGTYYDADQGR
CVLCPSGTYQDEEAQMSCEVCPGPEGRDVSKVVGARNMSECEGQCPPGQYSHDGFVPCLP
CPLGAYQPEVGRTNCFPCGGNLVTKHSGAVTFQECETKVQCSPGHYYNTSTHRCIRCPVG
TYQGEFGQNYCVSCPGNTTTDFDGSTYFMQCKTLSNSVTTYETCQTYERPIAFTSRSKRL
WIQFRSNEGNSGKGFQVPYVTYDEDYQELIEDIVRDGRLYASENHQEILKDKKLMRALFD
VLAHPQNFFNYTAQESREMFPKSFIRFLRSKVLRFLRP
Download sequence
Identical sequences G3PST5
ENSGACP00000020671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]