SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000020726 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000020726
Domain Number 1 Region: 114-250
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.47e-21
Family Ricin B-like 0.0034
Further Details:      
 
Domain Number 2 Region: 3-110
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.00000000000000161
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000716
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000020726   Gene: ENSGACG00000015704   Transcript: ENSGACT00000020765
Sequence length 257
Comment pep:known_by_projection group:BROADS1:groupII:10274676:10297055:-1 gene:ENSGACG00000015704 transcript:ENSGACT00000020765 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVYGGENVELGIRVWQCGGSVEVLPCARIAHIERAHKPYTEDLTSHVRRNALRVAEVWM
DEFKSHVYMAWNIPMEDPGIDIGDISERKALRKRLQCKTFRWYLVNIYPEMRMYSDTVAY
GVLKNSLKSDLCLDQGPENDNVPILYLCHGMTPQNVYYTSAQQLHIGLLSPTVDDDDNKC
LVDVNGRPRLIECSYATTKRMKLHWLFTQGGSIQNRKSKRCLELVVSSDNEFGYQLALQK
CTGQKWSITNVLFSGSL
Download sequence
Identical sequences G3PSZ0
ENSGACP00000020726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]