SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021140 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021140
Domain Number 1 Region: 369-427
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000197
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 2 Region: 236-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000363
Family Laminin-type module 0.053
Further Details:      
 
Domain Number 3 Region: 425-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000502
Family Laminin-type module 0.008
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021140
Domain Number - Region: 472-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00104
Family EGF-type module 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021140   Gene: ENSGACG00000016021   Transcript: ENSGACT00000021180
Sequence length 541
Comment pep:known_by_projection group:BROADS1:groupXIV:2773692:2807591:-1 gene:ENSGACG00000016021 transcript:ENSGACT00000021180 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQEKGNACTLSGKVGGGIENPYLCSDECDASNPDLAHPPQLMQDKERNGLLTYWQTVTW
RRHPEPLLANISMAWNKSLELTDDVQITFEYGRPSIMVLDKSMDHGRSWQPYQFYADDCM
DAFNMPPKRVRDLSPANITRVICTEQYSRWVGSKNDKNVKFEVRARFSVFAGARLQKMDD
LYTRMESMKGLRDFFTFTNLRMRLLRPALGGTYVQRDNLLKYFYAISNIEVPARRCKCNL
HAAQCLLQDGNLQCQCEHNTTGQDCQRCKKGFKAKSWKAGSYLPSPNGTPNSCTSGDRRA
LLFGNKLETSYLKAAPIFTATFTSKLISGHYFYSKQIEINWNDRNFSLVILKKKRPKDYC
ERVSFLSDCECYGHSNRCSYIDYLNIVTCVSCKHNTRGQNCQHCRLGYFRNASAELDDES
VCVECNCNQMGSVHDRCNGTGFCQCKDGAAGAKCDDCEPGYYWKQGCYSNVCDEEMLLCQ
NGGTCHQNQKCVCPPEFKGVLCQQSRCEAGKDCNAASSLHPPTATLLLCTLLAGLLATLS
P
Download sequence
Identical sequences G3PU53
ENSGACP00000021140 ENSGACP00000021140 69293.ENSGACP00000021140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]