SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021184 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021184
Domain Number 1 Region: 749-864
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-33
Family Spermadhesin, CUB domain 0.00051
Further Details:      
 
Domain Number 2 Region: 1454-1560
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.24e-33
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 3 Region: 1976-2084
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.09e-32
Family Spermadhesin, CUB domain 0.00056
Further Details:      
 
Domain Number 4 Region: 1799-1918
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-32
Family Spermadhesin, CUB domain 0.00075
Further Details:      
 
Domain Number 5 Region: 581-690
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-31
Family Spermadhesin, CUB domain 0.0005
Further Details:      
 
Domain Number 6 Region: 31-139
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.22e-29
Family Spermadhesin, CUB domain 0.00039
Further Details:      
 
Domain Number 7 Region: 1276-1387
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.75e-29
Family Spermadhesin, CUB domain 0.00045
Further Details:      
 
Domain Number 8 Region: 208-310
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-29
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 9 Region: 2143-2261
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.53e-29
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 10 Region: 409-520
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-28
Family Spermadhesin, CUB domain 0.00094
Further Details:      
 
Domain Number 11 Region: 1110-1213
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.02e-27
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 12 Region: 2331-2433
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-27
Family Spermadhesin, CUB domain 0.00088
Further Details:      
 
Domain Number 13 Region: 922-1045
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.33e-23
Family Spermadhesin, CUB domain 0.0026
Further Details:      
 
Domain Number 14 Region: 1621-1736
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-22
Family Spermadhesin, CUB domain 0.0056
Further Details:      
 
Domain Number 15 Region: 3041-3112
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 9.71e-19
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 16 Region: 2924-2993
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-18
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 17 Region: 2740-2809
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.1e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 18 Region: 2683-2751
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.8e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 19 Region: 3101-3170
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.91e-16
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 20 Region: 2982-3052
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.18e-16
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 21 Region: 346-416
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000431
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 22 Region: 1392-1462
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000667
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 23 Region: 525-587
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000834
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 24 Region: 3221-3289
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000138
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 25 Region: 2089-2158
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000264
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 26 Region: 2434-2507
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000292
Family Complement control module/SCR domain 0.00092
Further Details:      
 
Domain Number 27 Region: 1917-1981
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000306
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 28 Region: 2858-2918
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000486
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 29 Region: 2799-2866
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000598
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 30 Region: 144-204
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000917
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 31 Region: 695-763
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000153
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 32 Region: 1215-1279
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000256
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 33 Region: 1567-1630
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000292
Family Complement control module/SCR domain 0.0021
Further Details:      
 
Domain Number 34 Region: 2625-2687
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000375
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 35 Region: 1743-1806
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000702
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 36 Region: 2496-2562
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000823
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 37 Region: 870-930
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000148
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 38 Region: 3280-3337
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000181
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 39 Region: 3159-3216
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000306
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 40 Region: 2260-2323
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000364
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 41 Region: 1045-1106
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000769
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 42 Region: 2578-2630
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000445
Family Complement control module/SCR domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021184   Gene: ENSGACG00000016050   Transcript: ENSGACT00000021225
Sequence length 3566
Comment pep:known_by_projection group:BROADS1:groupII:13035298:13239947:-1 gene:ENSGACG00000016050 transcript:ENSGACT00000021225 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSFYRLLYAFLTSHTLAALSFGLPLSSSAESCGGVVQGLNGTIESPGFPHGYPNYANCTW
LIITGERNRIQLTFVTLALEEDFDIVSVYDGQPLPGNLKMRLSGFMQPSPLVSSGSILAL
WFTTDFAVSAQGFKAVYEVLPSHTCGTPGLIPNGVIHGSRYNMGDKIRYSCESGFVLEGH
SILTCIVSAGSGAQWDFPSPFCRAEGACGGTLRGTAGSITSPGYPAEYDNNLDCTWSVLS
EPGDTIALVFNDFLLEDKYDFLEISGTEAPSIWLTGTTLPSPVISNKNWLRIHFTSDSNH
RRKGFSAQYQVKKAIELKSRGVKMMPSKDTSHKNAVLSQSGLAGDVCPDPGVPENGKRMG
STFQIGASVQFSCDDSYVLQGSKSITCQRVTDTLAAWSDHRPICRTRTCGSNLKGPKGVI
TSPNYPVQYENNAHCVWVITAMESGKVIKLSFEEFDLERGYDTLTVGDGGKIGDTRRVLY
VLTGSSVPDLIVSLSNQMWLHLQSDDTIGSAGFKAVYEEIDRGGCGDPGVPAFGRRSGDR
FQHGDVLTFFCQSAFELVGEKTITCQHNNQWSGNKPSCIFSCFFNFTAPSGTVLSPNYPE
EYGNNLNCVWLIISEPGSRIHLLFADFDLEPQFDWLVIKDEGLSEPTTFGTFSGKDVPSQ
IASNGHIMRLEFQSDHSNTGKGFNISYTTFGQNECHDPGVPVNGQRYGDQFQLGSSVAFR
CDQGFIRTQGSDQVTCIIQDGNVVWSAAVPRCEAPCGGHLTAPTGVLLSPGWPSFYKDSL
NCQWVIEAQPDHAVKIHFDRFQTEVNYDTLEIRDGPSVSSPLVGEYHGTQAPHFLISTSN
VLFLLFTTDNSRSAAGFSIRYESVKMESDSCLDPGIPVNGRRHGTNFFIGSRVSFTCDLG
YTLSDQEPIVCEHIHQWSHALPSCDALCGGYVYGKTGTILSPGFPDFYPNSLNCTWTIEV
SHGKVLGVHLVFHTFHLEENHDYLSITEDSNFQVPVARLTGSVLPPSVRAGLYGNFSAQL
RFISDFSMSYEGFNMTFSEYDLEPCEDPGVPAYSRRTGFRFRVGDSLAFSCFTGYRLEGE
SKITCLGGGRRVWSNILPRCIAECGASSEGPEGVLLSPNFPSNYDNNHECIYHITTGKGR
GISLKAESFLLQDGDYLKMYDGENTSSRLLGNFTNDNMMGPVINTTSNRLWLEFNSNASG
TNQGFRLTYTSFDLVRCEEPGVPGYGYKIQDDGHFANTFVLYSCNPGYSLHGTSTLTCLS
GDRRVWDKPLPSCIAECGGHLTGAVGRILSPGYPAPYENNLHCTWTIEADTGKTISLHFI
VFDTEVGHDILRVWDGPSGPSDGGILLKEWSGPALPEDIHSTFNILTLQFDSDYFISKQG
FSIQFSTTTATTCNDPGVPVNGSRYGDTKEPGDSMTFQCDPGYQLQGPDTITCVRLDNRF
YWQPDPPTCVAAMCGGNVSGPSGVILSPNYPQPYPPGKECDWRIRVNPDFVIALIFKSFN
MEPSYDFLHIYEGEDSNGPLLASLQGNQAPERIESSGNSLFLAFRSDASLGMSGFAIEYK
EKPREACFDPGNIMNASRTGYDYKLGSQVSYSCHHGYITMGGDTITCVMGNDGKPVWDQA
LPSCKAPCGGHYGGSEGVVLSPNYPLNYTTRQTCSYFITVSTQFVVFGQFAVFQTAMNDS
VELFDGANENARLLSSLAGSHSGETLPLATSNQIMLRFNAKSDQSARGFHFVYQAVPRTS
DSQCSSVPEPRYGRRIGSEFSAGSVVRFECSPGYLLKGSSAIWCQAVPGALAQWNATTPS
CLVPCSGNLTERRGTILSPAYPEPYPNSLNCLWRIHVSEGAGIQIQVMTFATEHNWDSLE
IYDGGDMTAPKLGSFSGTTAPALLNSTSNQLLLHFQSDISVVAAGFHLEYKTVGLTTCPE
PMIPANGIKAGDRYMVNEVVAFTCEPGYTLQGHSHISCMPGTVRRWNYPPPLCIAPCGGV
LSEMSGVILSPGFPGNYPGNLDCTWKITLPTGYGAHVQFQNFSSEDNHDFLEVRAGPQHS
SALIGQYTGSQMPPPLLSTTHLTIIHFYSDHSENRPGFKLTYQAYQLQNCQDPFPFPNGD
IINSDFSAGQLVTFHCYPGYVLIGHPVLTCLHGTNRKWNHPFPRCEAPCGYNVTAENGTI
YSPQYPNEYPNSQDCSWLITVPHGHGVYINFTLLQTEPVTDYIAVWDGPDTSSPQLGVFS
GNTALESAYSTSPKVRIRFHSDFSTGGFFILNFHAYRLKKCPPPPVVENAEVIYEDQDFQ
IGDIVKYRCLPGYTLVGKAELMCRLNSHLLFEAPAPTCQAQCPANEERPLSSGVILSPGF
PSNYPNSQTCSWLLHILPGYTINIYVEMFHSEKQFDELEIFDGSSGQSPLLVALSGNHSS
QLNFTSKTNQLYLRWSTDHATNKRGFKIRYSAAYCSINDPPVNGGVINRTRLRPGSRLQF
YCNRGYRMIGSSNATCRLHPNGLFQWDTPPPFCQAVSCGIPQSPGNGSFHANQYTVGSQI
TYHCNQGFHLDPNVQTTAVCLEEGSWSNAAIAPRCLPLHCPSTDGTLSDQMTSRLLSGSL
EEFGSMLMLECATGYYLGVGHRTLRCLANGTWEGSDDLATCKIISCGDLPSPPFGSKLGT
LTTFGATAIFMCNHGYTLVGSHVRECGANGLWSGAETRCLAGHCDSPDPIVNGHISGDGS
SYRDTVVYQCMLGYRLIGTSVRICQQDHRWSGTTPVCVPITCGHPGNPGNGRTNGSEFNL
NDVVNFTCNKGYILGGNARAQCRLNGQWSSPLPVCKVVNCSDPGHVENGVRQSGLRYPEV
FSYGVTVAIHCKRGFYLLGSALLSCQHDGRWDRPIPRCLAISCGDPGGPPNAVVTGSHSW
TYSSVLQYSCLPGGLLVGNTTRHCQEDGTWSASPPYCTGVSPGICGDPGMPPHGARLGGE
EFKTKSLLRFSCEAGYSLIGSAERTCLHNGTWSGTQPVCQAVSCGNPGTPAHGRIVFSDG
ITFGSSVAYACWDGFKTSGLTTRHCTTNGTWTGQPPDCTVITCGDPGQVANGIFFGSEFA
FNHTVTYRCNPGHLMEPPGHSVLLCTKDGTWNQTKPSCKVIQCGPPPQVHHGKVEGTDHS
WGSSVSYSCFHGYQLSTSAVLSCEGNGTWTGDVPKCLPVLCGDSGSPGGGFREGNIFSYR
SEVRFYCHSPYLLVGSASRVCQADGMWSGHQPACIDQAFNNCRDPGTPAYGIPIMGQGFQ
VGNKISFKCRKNYHILGSTTRTCLENLTWSGTQPECIAHSCRQPETPSNVDVRSMDLPTL
GYTLIYTCQDGFYLAGGSEHRTCKSDGRWSGKPPLCKGRGDSDVQKNKIRVPVDVFSPNS
EWSGFYEYLGKRLATTFTVTGFNATSGRVNVTLLETSGVSIRLSGTYKSEENQLLLKVYQ
VKGPTEHYYSKFKNDNWAIDGHVTAESDQRTFVYQGHIHSKDFGKFHLTRQGPVTMAMDP
SNPYTNSSSVAAAILVPFFALILSGFAFYLYKHRTRPKVQFNGYVGHESTNGQASFENPM
YDTNMKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences G3PU97
69293.ENSGACP00000021184 ENSGACP00000021184 ENSGACP00000021184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]