SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021185 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021185
Domain Number 1 Region: 362-433
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.08e-19
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 61-130
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 6.39e-19
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 3 Region: 245-314
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 7.23e-19
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 4 Region: 4-72
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.22e-18
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 422-491
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 8.06e-17
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 6 Region: 299-361
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000236
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 7 Region: 542-610
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 8 Region: 179-239
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000903
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 9 Region: 120-187
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000012
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 10 Region: 601-659
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000181
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 11 Region: 480-537
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000584
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021185   Gene: ENSGACG00000016050   Transcript: ENSGACT00000021226
Sequence length 874
Comment pep:known_by_projection group:BROADS1:groupII:13035298:13061115:-1 gene:ENSGACG00000016050 transcript:ENSGACT00000021226 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TAGHCDSPDPIVNGHISGDGSSYRDTVVYQCMLGYRLIGTSVRICQQDHRWSGTTPVCVP
ITCGHPGNPGNGRTNGSEFNLNDVVNFTCNKGYILGGNARAQCRLNGQWSSPLPVCKVVN
CSDPGHVENGVRQSGLRYPEVFSYGVTVAIHCKRGFYLLGSALLSCQHDGRWDRPIPRCL
AISCGDPGGPPNAVVTGSHSWTYSSVLQYSCLPGGLLVGNTTRHCQEDGTWSASPPYCTG
VSPGICGDPGMPPHGARLGGEEFKTKSLLRFSCEAGYSLIGSAERTCLHNGTWSGTQPVC
QAVSCGNPGTPAHGRIVFSDGITFGSSVAYACWDGFKTSGLTTRHCTTNGTWTGQPPDCT
VITCGDPGQVANGIFFGSEFAFNHTVTYRCNPGHLMEPPGHSVLLCTKDGTWNQTKPSCK
VIQCGPPPQVHHGKVEGTDHSWGSSVSYSCFHGYQLSTSAVLSCEGNGTWTGDVPKCLPV
LCGDSGSPGGGFREGNIFSYRSEVRFYCHSPYLLVGSASRVCQADGMWSGHQPACIDQAF
NNCRDPGTPAYGIPIMGQGFQVGNKISFKCRKNYHILGSTTRTCLENLTWSGTQPECIAH
SCRQPETPSNVDVRSMDLPTLGYTLIYTCQDGFYLAGGSEHRTCKSDGRWSGKPPLCKVP
VDVFSPNSEWSGFYEYLGKRLATTFTVTGFNATSGRVNVTLLETSGVSIRLSGTYKSEEN
QLLLKVYQVKGPTEHYYSKFKNDNWAIDGHVTAESDQRTFVYQGHIHSKDFGKFHLTRQG
PVTMAMDPSNPYTNSSSVAAAILVPFFALILSGFAFYLYKHRTRPKVQFNGYVGHESTNG
QASFENPMYDTNMKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences G3PU98
ENSGACP00000021185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]