SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021212 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021212
Domain Number 1 Region: 24-194
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.83e-69
Family Ephrin receptor ligand binding domain 0.00000039
Further Details:      
 
Domain Number 2 Region: 609-863
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.56e-58
Family Protein kinases, catalytic subunit 0.00000000362
Further Details:      
 
Domain Number 3 Region: 323-527
Classification Level Classification E-value
Superfamily Fibronectin type III 3.28e-39
Family Fibronectin type III 0.00011
Further Details:      
 
Domain Number 4 Region: 249-329,361-377
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000065
Family Growth factor receptor domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021212   Gene: ENSGACG00000016078   Transcript: ENSGACT00000021253
Sequence length 904
Comment pep:known_by_projection group:BROADS1:groupIII:9305144:9323989:-1 gene:ENSGACG00000016078 transcript:ENSGACT00000021253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YAFIVTALSKSECVWVDVMKDEEKTLIDSRWATTELAWTTFPESGWEEVSGYDDSMSPIR
TYQVCNVRQPNQNNWLRTDFIPRKGVLRVYVELKFSVRDCASIPNIPGSCKETFNLFYYE
SEGDTATEASPLWRENPYVKVDTIAPDESFSLLEAGRINTKVRSFGPLSKAGFYLAFQDL
GACMSLISVRVFFKKCSTTIANFAVFPETATGAEATSLVIAPGACVTNAMEVSVPLKLYC
NGDGEWMVPVGSCTCVAGFEPSADGTQCQACIPGTFKSKYGEGSCTPCPPNSRTSARGAN
ICPCQSGFYRADSDPPDSACTTIPSAPQNVISSVNETSLSLEWEDPEDTGGRSDLVYNVV
CKKCLRDRSPCTRCDDNVDIAPRRLGLRPRKVVVRNLQAHTRYSFEVQAVNGVSGKNPTS
PSYSTVNITTNQAGTAAPSAVPTVHLMRSTSDALSLSWLPPEKPNGVILDYEIKYHERGQ
AMSHTVTSQHSSAKVEGLRAATSYLVQVRARTVAGYGRYSNPMDFSTSLHSNPQKSVQDQ
LPLIIGSASAGLVVIVALVVIAVVCLKKQRSGSELEYTEKLQQYISPGVKVYIDPFTYED
PNDAVHEFAKEIDISCVKIEEVIGAGEFGEVCRGRLKQSGRREMVVAIKTLKAGYTECQR
RDFLAEASIMGQFDHPNVIRLEGVLTRSCPVLIITEFMENGALDSFLRLNDGRFTMTQLV
GMLRGIAAGMKYLSDMSRFLDDTSADPTYTSSLGGKIPIRWTAPEAIAFRKFTSSSDVWS
YGIVMWEVVSYGERPYWDMSNQDVMTAVEQDYRLPPPMDCPMVLHQLMLECWMKERNLRP
KFCRIVSTLDKLLRNAASLKVVTSTYSGDLLRLGGTLPGHNRKSPESCEEIARQQMSQTL
PIRV
Download sequence
Identical sequences G3PUC5
69293.ENSGACP00000021212 ENSGACP00000021212 ENSGACP00000021212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]