SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021243 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021243
Domain Number 1 Region: 267-323
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000337
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 2 Region: 170-231
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000189
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 3 Region: 50-106
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000486
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 4 Region: 112-165
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000675
Family Complement control module/SCR domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021243   Gene: ENSGACG00000016104   Transcript: ENSGACT00000021284
Sequence length 385
Comment pep:known_by_projection group:BROADS1:groupIII:9402021:9405305:-1 gene:ENSGACG00000016104 transcript:ENSGACT00000021284 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MINWLHVNWLSALLRLGDLVCDKMGWRRYFGFVLLVWFQRLQHVRPSDQPCSAPELNGGY
LVPEQSSYDHKTTLYYGCDNGRKPAVEGWWATSTCLDGIWSPKPQCIDETACIEPHIPNV
KETTSGWYNNKYKKRIECLDGYDLKGNAATTTCTNGTWSPVLVCEKNINSCEEPPQIPHA
VIIHRGYQEIFPDSTELEYECEDGYSVDAANSKESLYCISGNWIPSPPCLWGRAGGGRGT
STGTETQPEGHTTSDDRGTRAVVRVTNCAERPTVANGDVVEIGEMFLKYQCNNYYKLVGP
EKVVCYSNGLWSEVPTCKANFCSVDTDRDPKFISDGVKFVGNGEKLRLECEETGIFVQYS
DGVCTDGRIEFSACCNRLQLRTGVC
Download sequence
Identical sequences G3PUF6
ENSGACP00000021243 69293.ENSGACP00000021243 ENSGACP00000021243

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]