SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021261 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021261
Domain Number 1 Region: 58-565
Classification Level Classification E-value
Superfamily Heme-dependent peroxidases 9.54e-186
Family Myeloperoxidase-like 0.000000000000473
Further Details:      
 
Domain Number 2 Region: 18-55
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000306
Family EGF-type module 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021261   Gene: ENSGACG00000016097   Transcript: ENSGACT00000021302
Sequence length 586
Comment pep:known_by_projection group:BROADS1:groupXIV:3146400:3151614:-1 gene:ENSGACG00000016097 transcript:ENSGACT00000021302 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FNRERLRRPDCGLGQCMNPCCYLPCQHWGACVRYGEDKYECDCTRTGYSGENCTVPEFWT
RVRLLVKPSPDVQHYVLTHFNRLWDVINSSFLQNVLMRLVLTVRSNLIPSPPTYNSKYGY
LSWESYYNLSYYTRILPPVPKDCPTPLGVKGEAGLPDPELLVDRLLKRRTFRPDPQGSNL
LFAFFAQHFTHQFFKTYNRMGVGFTKALAHGVDAGHVYGDNLQRQLRLRLHKDGKLKYQL
VKGEMYPPSVADAPVRMSYPPGVPPKAQMAIGQEVFGLLPGLGMFATLWLREHNRVCDIL
KAEHPTWDDEQLFQTTRLVIIGETIKIVIEEYVQHLSGYLLQLKFDPTLLFNSGFQYGNR
IALEFSQLYHWHPLMPDSFLINGDELSYKQFLFNNSVLTDYGIEKLVDAFSRQVAGQVGG
GYNIHAAVTNVAVVTIKESRQLRMQPFNEYRKRFNLQPYTSFSQFTDNEEIARELEELYG
DIDAMEFYPGMMLEKTRQGAIFGESMVEMGAPFSLKGLLGNPICSPSYWKPSTFGGQVGF
DIVNSATLKKLVCQNTRTCPYVAFRIPTEEQSKRGNGDSKTRTDEL
Download sequence
Identical sequences G3PUH4
ENSGACP00000021261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]