SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021373 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021373
Domain Number 1 Region: 132-340
Classification Level Classification E-value
Superfamily L domain-like 1.36e-38
Family Ngr ectodomain-like 0.00037
Further Details:      
 
Domain Number 2 Region: 1000-1194
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.73e-38
Family Laminin G-like module 0.0033
Further Details:      
 
Domain Number 3 Region: 359-566
Classification Level Classification E-value
Superfamily L domain-like 4.59e-37
Family Ngr ectodomain-like 0.0000277
Further Details:      
 
Domain Number 4 Region: 607-742
Classification Level Classification E-value
Superfamily L domain-like 1.02e-34
Family Ngr ectodomain-like 0.0034
Further Details:      
 
Domain Number 5 Region: 771-811
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000676
Family EGF-type module 0.0043
Further Details:      
 
Domain Number 6 Region: 932-970
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000195
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 7 Region: 813-858
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000303
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 8 Region: 893-931
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000186
Family EGF-type module 0.011
Further Details:      
 
Domain Number 9 Region: 1-48
Classification Level Classification E-value
Superfamily L domain-like 0.000000198
Family Ngr ectodomain-like 0.027
Further Details:      
 
Domain Number 10 Region: 850-892
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000502
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 1234-1269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000199
Family EGF-type module 0.025
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021373
Domain Number - Region: 1275-1311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000105
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 1191-1231
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000607
Family EGF-type module 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021373   Gene: ENSGACG00000016196   Transcript: ENSGACT00000021414
Sequence length 1396
Comment pep:known_by_projection group:BROADS1:groupIX:1803770:1827074:-1 gene:ENSGACG00000016196 transcript:ENSGACT00000021414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLSENQIQGVPRKAFRGAVEIKNLQLDYNHISCIEDGAFRALRDLEVLLTCRARCGAPEF
SLTATELLSIKEKYAEKTIKPSAEYLKPEHRLGLYSSAWPPALWGHNVAEVQRRSSLCVG
HQSSSSSSCSVLQCPESCTCSNNIVDCRGKGLTEIPTNLPETITEIRLEQNAIKVIPAGA
FAPYKKLRRIDLSNNQISELASDAFQGLRSLNSLVLYGNKITEISKALFEGLFSLQLLWL
LNANKIACLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSSLRAIQTLHLAQNPFICDCHL
KWLADYLQDNPIETSGARCTSPRRLANKRIGQIKSKKFRCSGTEDYRSKLGGDCFADLAC
PEKCRCEGTTVDCSNQKLTKIPDHVPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINLS
NNRISDIEEGSFEGASGVNELILTSNRLENVHHRMLKGLSGLRTLMLRSNRISCVSNSSF
VGLSSVRLLSLYDNQITSMNPGAFDTLHSLSTLNLLANPFNCNCHLAWLGDWLRRKRIVT
GNPRCQSPYFLKEIPIQDVAVQDFACEDGNDDNSCSPVLRCPAECSCLDTVVRCSNKGLT
TLPKGLPKETTELYLDGNHFTQVPAELSDYKHLTLIDLSNNQISTLSNHSLSNMSELLTL
ILSYNRLRCIPVRAFDGLKSLRLLSLHGNDISLIPEGAFKDLSALSHLALGANPLHCDCH
MQWLSDWVKSGYKEPGIARCAGPGDMTDKLLLTTPSKKFTCTAGPVDVSIQAKCEPCLSN
PCRNDGTCSNDPVHYYRCSCPYGFKGQNCEEPIHACIGNPCQNGGTCHLKEGGGGNFWCV
CAEGFEGDSCEINFDDCEDNDCENNSTCVDGINNYTCMCSPEYTAGELCEEKLDFCAPEL
DPCKHDSKCILTPRGYKCECTPGYVGEHCDMDYNDCEENKCQNGGQCIDAVNGYTCVCTE
GNSGLFCEFSPPMVLPRTSQCDTHDCLNGAQCVVTGAEPRCQCLHGYQGERCQTLASVSF
VDRESYLQLPAGLLAPETNISLQIATDEDSGVLLYKGDSDHIAMELYRGRLRVSYETGSY
PPSAIYSVETVNDGSFHAVELVASDQTLSLSIDGGPPKSINSISKQSTLNIDSPLYLGGM
PERASSSGGLSSLQHSSGGRNGTSFHGCLRNLYVNGKLQDLTIEWLGRGVEAGCQPCQRG
ACVQGDCHPTGHRGFTCTCHPGWTGTACDLQVNNPCDGNKCVHGTCLPINSYSYSCRCQP
GFAGVLCDEPDQDAANPCTPSRCKHGRCRVSGLGKAYCECNGGYTGEVCDKEVACRGERV
RDVYQRQQGYAACQTQEKVSRLECRGSCAGGADGQGTCCTPLRSKRRKYTFQCTDGSSFV
QEVEKVVKCGCTNCSS
Download sequence
Identical sequences G3PUT6
ENSGACP00000021373 ENSGACP00000021373 69293.ENSGACP00000021373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]