SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021384 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021384
Domain Number 1 Region: 430-693
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-55
Family YWTD domain 0.0000000735
Further Details:      
 
Domain Number 2 Region: 346-423,693-744
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000122
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 3 Region: 225-263
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000537
Family LDL receptor-like module 0.00053
Further Details:      
 
Domain Number 4 Region: 62-102
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000072
Family LDL receptor-like module 0.00091
Further Details:      
 
Domain Number 5 Region: 27-64
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 6 Region: 262-302
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000236
Family LDL receptor-like module 0.00036
Further Details:      
 
Domain Number 7 Region: 174-210
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000288
Family LDL receptor-like module 0.00063
Further Details:      
 
Domain Number 8 Region: 103-145
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000144
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 9 Region: 307-344
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000223
Family LDL receptor-like module 0.00083
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021384
Domain Number - Region: 151-179
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.017
Family LDL receptor-like module 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021384   Gene: ENSGACG00000016207   Transcript: ENSGACT00000021425
Sequence length 922
Comment pep:known_by_projection group:BROADS1:groupIII:9728901:9775986:1 gene:ENSGACG00000016207 transcript:ENSGACT00000021425 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ICKLHYTRSLFHCIRLLLLHLLLPATDECEDGQFQCNNKRCIPTIWRCDDDDDCSDNSDE
ENCPRKTCAPAEFACLNGQCVPGRWRCDGEPECPDGSDEAAETCSKQTCPPEKFDCGGST
NKCVSLSWRCDGEKDCENGADEEDCASDAKACPSGEFMCANRKCLATVYACASPLTCGPN
HLRCNTSECVPLMWSCDGDPDCADSSDEGPERCGGDGAPYLLNRRINCTAEEFRCANGEC
VRLTWKCDGDPDCKDKSDESECPLLTCRPDEFQCGDGSCIHGTKQCNKVHDCPDHSDESG
CVNATKCEGPLKFLCKNGECIDSAKVCDSVKDCKDRSDEPKKECGLNECMINNGGCSHVC
TDRPIGFECQCPTGYQLLDKKTCGDIDECENPDACSQICINYKGDFKCECHEGYEIDPAT
KTCKAEGKSPYLLFTNRHEIRRIDLVKRDYSQVVSTQKNAVALDLDVANNRVFWCDRFHR
KIYSAFIHEASDPSQQVPLLDSLLQTPVGLALDWLQHNLYWADSGDKSISVASVDATKRR
VLINSDLSEPRAIALDPHHGFMYWSDWGTRAKIEKAGMNGVDRRVLVADNIEWPNGITLD
VANRRLYWVDSKLHLIASVDLNGAHRRTHVSSAETLGHPYALAVFEDRIYWTDRDRSAVF
MANRLTGQDIHTLAENLNDPHDIVVFHQLRQPQGPDSCNLGSVANGGCEYLCLKAPQITE
HSPKYTCACPDGQDLGPDMRGCVPGFTPGTRATLAEDFPPPSGGVSQADATPHLTTAPSG
APDLLTPDSTLKGRESKVPGGSHSTATAMVTSTTPARDSSVSQHSGSENFLLGENLTVAV
LGVVIPIVVFSLVCAGVYLVWRNWRRNSTKSMNFDNPVYRKTTGEGEEDEIHIGRTDGMG
HHGHHHPYPQGVNVGVVGAGVG
Download sequence
Identical sequences G3PUU7
ENSGACP00000021384 69293.ENSGACP00000021384 ENSGACP00000021384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]