SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021416 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021416
Domain Number 1 Region: 142-240
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000129
Family I set domains 0.021
Further Details:      
 
Domain Number 2 Region: 24-107
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000141
Family Growth factor receptor domain 0.002
Further Details:      
 
Domain Number 3 Region: 94-139
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000424
Family Ovomucoid domain III-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021416   Gene: ENSGACG00000016231   Transcript: ENSGACT00000021457
Sequence length 262
Comment pep:known_by_projection group:BROADS1:groupIV:26590:32106:1 gene:ENSGACG00000016231 transcript:ENSGACT00000021457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFILFLWILSAAPVLSVRVLAGPGCASCDPSQCASLPVEGCPSGSLLDSCACCSVCAASE
GQTCGGRRADARRCGAGMECVKGDAHKKNKLGVCVCKSNYEVCGTDGVTHSSGCALKSAS
LTAEKEGKEPISVQNKGRCSTAPVIVTAPAEVYNVSGSQVYLSCEAMGVPTPVLTWKRVL
SGKKRMELLPGDRDNLAIQTRGGPEKHEVTGWVLISPLTEEEEGLYECHATNAKGEASAI
GAIHLVESSNDIVKKVTQEDEL
Download sequence
Identical sequences G3PUX9
69293.ENSGACP00000021416 ENSGACP00000021416 ENSGACP00000021416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]