SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021563 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021563
Domain Number 1 Region: 533-578
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000589
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 106-142
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000017
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 3 Region: 48-96
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000275
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021563
Domain Number - Region: 488-524
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000107
Family EGF-type module 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021563   Gene: ENSGACG00000016323   Transcript: ENSGACT00000021604
Sequence length 579
Comment pep:known_by_projection group:BROADS1:groupIII:10057587:10062502:1 gene:ENSGACG00000016323 transcript:ENSGACT00000021604 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSALTSHCCLLCVTLVLLSYVAVTKADNEEPSVRQARSAADQVVVHPVDCVLSGWSSWSR
CDVCQKKRFRYAKLDQPSQFGGQPCNFYGEEEEACAVPAHYTCVTVPLCEGFLCNQTGRC
IPRTLQCSGEDDCGDMSDEAGCKNVPKPCSSEAEEYWGIENLAKGINILNSNLGGVVLDN
RYYAGSCLPHYIEDVRFRKPYNLLHYTLQTKGSYDFTMQSFKSYKEYKDHVVKEHYSQTT
FSFGIAVPGVFEVAFNFNNEKYSKAERKIRRASSKTNSFVRAKAELELAQYILKSDDLML
HPEFLQRLRSLPQTYVYGEYRQIYRDYGTHYITEAALGGDYEYTVILNKEKLEKTDYSLD
DYKRCTQAGLKVGANIKGIYVALGIQGGSCDALLNEFGEDTEHGSMVEDFVSVVRGGSSE
TITALVSKKLPTPELMGLWGEGVRYNPDFIRKTIRPLFELVISRDFSYPEILKRNLRRAL
SEYLAEASPCRCAPCRNNGVAVLKGTRCDCVCPVGYSGRGCEITSRRKEIAIEGSWSCWG
AWSPCSGGTMTRSRQCNNPAPSEEDLACRGLKQESTECF
Download sequence
Identical sequences G3PVC6
ENSGACP00000021563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]