SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021571 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021571
Domain Number 1 Region: 567-612
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000034
Family TSP-1 type 1 repeat 0.00098
Further Details:      
 
Domain Number 2 Region: 121-161
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000258
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 3 Region: 522-561
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000887
Family EGF-type module 0.034
Further Details:      
 
Domain Number 4 Region: 67-114
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000968
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021571   Gene: ENSGACG00000016338   Transcript: ENSGACT00000021612
Sequence length 612
Comment pep:known_by_projection group:BROADS1:groupIII:10062738:10067343:-1 gene:ENSGACG00000016338 transcript:ENSGACT00000021612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CQIRSKGSGYVSSAMGTFIKLLLAVCTLLLTANFIPIVNTYRSPWTPSDYSMAGSRRARA
VNRPAPINCQLQAWSSWTSCDSCTDQKGRFRRMEKPSQFGGTECVESLWEKLACPSAATE
CLVTDYCGERFTCKETGRCISQSLRCNGESDCNDFSDEDGCEVVNRRGDKCSTLLPIPSA
ERGTQGYNVLTGDFVDRVLDSNYFGGKCEYVYNGEWRKFIYEAVCENLRYNEDEKNYRKP
HNYHTYQFVAEATSEGSQDYFTDAVSLLNARKTMSSANGGVTLGIYKVEVGLSGSSESEF
FNNVTQYNSQELGFVRLFSKVQTAHFKMRSNKLMLDEEFYVSLMELPEQYHFGTYSRFFN
TFGTHYVTEGTMGGTLEYVVVLNKTAMAESNTEAEQAGVCLGASIGLSQNLSTNVNVDLK
VKGNVCRKERSTHRTNDSDSAEIVDIVSLVKGGVTHSSAGLLAIRNPDTYRSWGASLRYN
PTLIEYETMPIYELVRLSTAADHVGARLANLERGWDEYQRQFDSCRCAPCRHNGIPVLTG
TSCRCVCKPGFQGKACEETLRKDAPTDGSWSCWGAWSSCSSGKKTRTRTCDNPAPDGGGT
TCLGSSSQAQRC
Download sequence
Identical sequences G3PVD4
ENSGACP00000021571 ENSGACP00000021571 69293.ENSGACP00000021571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]