SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021649 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021649
Domain Number 1 Region: 1216-1305,1333-1552
Classification Level Classification E-value
Superfamily NHL repeat 3.92e-24
Family NHL repeat 0.002
Further Details:      
 
Domain Number 2 Region: 911-986
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000137
Family Pre-dockerin domain 0.051
Further Details:      
 
Domain Number 3 Region: 1522-1541,1572-1677
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0000105
Family SGL-like 0.039
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021649
Domain Number - Region: 748-774
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000148
Family Integrin beta EGF-like domains 0.042
Further Details:      
 
Domain Number - Region: 619-644
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000187
Family Integrin beta EGF-like domains 0.077
Further Details:      
 
Domain Number - Region: 652-677
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00047
Family EGF-type module 0.033
Further Details:      
 
Domain Number - Region: 719-743
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00103
Family Integrin beta EGF-like domains 0.064
Further Details:      
 
Domain Number - Region: 782-820
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00142
Family EGF-type module 0.081
Further Details:      
 
Domain Number - Region: 585-612
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00161
Family Integrin beta EGF-like domains 0.046
Further Details:      
 
Domain Number - Region: 555-579
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0258
Family EGF-type module 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021649   Gene: ENSGACG00000016390   Transcript: ENSGACT00000021690
Sequence length 2756
Comment pep:known_by_projection group:BROADS1:groupIX:3773379:3928846:1 gene:ENSGACG00000016390 transcript:ENSGACT00000021690 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVKERRPYCSLTKGRRDREGPYTGSSVDSEDCAIGSQGLRVPTQKSYSSSETLKAFDQH
QDQARLLYGTTKGYKDMVQREQDDYNRQGQHFSLRQLGVCEPPSRRGLAFCSEMGLPHHG
FSVGTTQDVDADSQAVMSPERAMRLWGRGGLGKSSGRSSCLSSRSNSVLTLTDTEHENKS
DSDNEQPSNHHGPALPPAPPPHRQQPSVTALNQSLGPTHHAGHSLNSTRQLTPPIGNPAA
VAGQSPAELQTTPPESVPLQDSWVLGSNVPLETRHFLFKTGTGTTPLFSTATPGYTMATG
SVYSPPTRPLPRNTLSRSAFKFKKSSKYCSWRCTALSAVGLSVLLSILLCYCIAMHLFGL
NWQLQESEGYGAFENGGGGRDTTPNTFMVSTDNGKMFLLENSTIDTGELDVGRQAIQDVP
PGVFWRSQLYIDQPQFLKFNISVQRDALVGVYGRKGLPPSHTQYDFVELLDGSRLISKRS
LSDVYVGHAHPAAAHEEEPGGGARRARSVNVHEAGFIQYLDTGIWHLAFYNDGRNAEQVS
YNTVVIESIMECPQNCHGNGDCLSGICHCFPGFLGPDCSRASCPVLCSGNGQYSRGRCQC
YSGWKGTECDVPTNQCIDIHCGGHGICIVGACICNTGYKGDNCEEVDCIEPSCSTHGVCI
HGECHCQPGWGGASCEIVKAMCPDQCSGHGTHNADTSTCTCDDNWTGPDCSLEVCEVDCG
SHGVCYGGVCRCEEGWTGALCDQKACHPLCSKNGVCKEGKCECDQGWTGEHCNIAHNPDI
RVKEGCPGLCNNNGRCTLEASGWHCICQSGWRGAGCHVAMETLCTDGKDNEGDGLTDCMD
PDCCLQPSCQNQLYCKGSPDPGEVLSQSPSSLVPQQAARSFHQRIHFLVGPESTHVIPGD
SPFNKSLVSIIRGQVLTADGTPLIGVNVTFVHFPEHGYSVTRQDGMFDLLANGGASLTLS
FERAPFLTQYRTVWVPWNVFYVMDTLVMKKEENDIPSCDLSGFIRPSPVIVASPLSTFYR
SSSEDGPIIPETQVLQEETSIPGSDLNLIYLSSRAAGYKPVLKVTMTQSSIPFNLMKVHL
MVAVVGRLFQKWFPAQPNLSYTFIWDKTDAYGQRVYGLSEAVVSVGFEYESCLDLILWEK
RTSILQGYELDASNMGGWMLDKHHILDVQNGILYKGNGENIFISQQPPVISSIMGNGRRR
SISCPSCNGQAEGNKLLAPLALACGADGSIFVGDFNYIRRIFPSGNVTSVMELRNKDFRH
SNNPAHRYYLATDPVTGQLYVSDTNSRRIYRPKMLSGARDLISNGEVVAGTGEQCPPFDE
ARCGDGRKATEAQLLGPKGIAVDRNGLIYFVDGTMIRKIDRNGIISTMLGSNDLTSARPL
TCDTSMHIRQVRLEWPTDLTINPMDNSIYVLDNNVVLQITENRQVRIVAGRPMHCQVPGI
EYTMGKRAVQTMLEGATAIALSYSGVLYIAETDEKKIHRIRQVSTDGEITHLAGELSDCD
CKNDANCDCYQTGDGYAKDARLNCPSSLVVSPDGTLYMADLGNIRIRAIRCNQPPTGSLA
SGPSSYEVASPASQELYVFDGNGTHQFTMSLVTGDYKYNFSYSNDEDVTAVTDSSGNTLR
IRRDTNRMPVRVVAPDNQVIWLTIGTNGGLKTLTAQGQELVLFSYHGNSGLLATKSLQIG
WTTFYDYDSEGRLTNVTFPTGVVTNLHGDMSSGAVAVDIETSGRDEDVSITTNLSSIDSF
YTLVQDQLRNSYQVGNDHSLRVIYANGMDTHYQTEPHILAVQGAANPTVARRNMTLPGEN
GQNLVEWRFRKEQTRGKVIVFGRKLRVNGRNLLSVDYDRSLRTEKIYDDHRKFMLKIIYD
TQGHPTLWVPSSKLLSVNLTYSSTGQVTGLQRGPTTERWEYDNQGRIISRVFADGKTWSY
TYLDKSMVLLLHSQHQYIFDYDSGDRLSAVTMPSVARHTMQTIRSIGYYRNIYSPPESNA
SVTVDYSEDGQLLGVAHLGTGRRILYKYRRQNKLAEILYDSTRVSFTYDETAGVLKTVNL
QSEGFICSIRYRQIGPLVDRQIFRFSEDGMVNARFDYTYDNSFRVTSMQAVINETPLPID
LYQFDDISGKVEQFGKGVIYYDINQIISTAVMTYTKHFDQHGRIKEIQYEIFRSLMYWIT
IQYDNMGRVTKREIKIGPFANTTKYGYDYDVDGQLQTVSLNEKMMWRYNYDLNGNLHLLN
PGNSGRLTPLRYDLRDRITRLGDVQYRLDEDGFLRQRGAEIFEYNSKGLLVRVYSKAASW
TIQYRYDGLGRRVASRNSLGQHLQFFYADLNYPTRITHVYNHSSSEITSFYYDLQGHVFA
MEISSGEEFYIACDNTGTPLAVFSNNGLLLKQVQYTAYGEVYFDSNPDFVLVIGFHGGLY
DPLTRLLHFGDRDYDIPAGRWTTPDISTWTRVGKDPQPFNLYMFRGNNPISKIQQVKEYV
TDVNIWLVTFGFHLHNAIPGFPIPKFDLTQPSLEMKKSQLWDDLPSISGVQQMVTRQSQA
FLSFERMPEIQLTRRHSDHAKPWLWFSTVKSLIGKGVMLAVIQGRVVTNALNIANEDCIK
VAAVLNNAFYLDDLHYTVEGRDTHYFIKTSLPENDLSALRLTSGRKSLENGVNVTVSQST
TVMNGRTRRFADVELQYGALTLHVRYGTTLDEEKARILEHARQRALASAWAREQQRVRDG
EEGVRLWTEGEKRQLLSSGKVLGYDGYYVLSIEQYAELADSANNMQFLRQSEIGRR
Download sequence
Identical sequences G3PVL0
ENSGACP00000021649 69293.ENSGACP00000021649 ENSGACP00000021649

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]