SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021833 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021833
Domain Number 1 Region: 36-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000405
Family EGF-type module 0.044
Further Details:      
 
Domain Number 2 Region: 134-159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000723
Family EGF-type module 0.049
Further Details:      
 
Domain Number 3 Region: 104-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000142
Family EGF-type module 0.057
Further Details:      
 
Domain Number 4 Region: 170-204
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000257
Family EGF-type module 0.075
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021833
Domain Number - Region: 5-29
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00127
Family EGF-type module 0.063
Further Details:      
 
Domain Number - Region: 70-97
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00176
Family Integrin beta EGF-like domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021833   Gene: ENSGACG00000016524   Transcript: ENSGACT00000021874
Sequence length 274
Comment pep:known_by_projection group:BROADS1:groupIV:2084023:2093585:-1 gene:ENSGACG00000016524 transcript:ENSGACT00000021874 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ECTHNCYGNGECVAGSCHCFPGFIGPYCSRVDCADPACSAHGACHHGECHCNPGWGGASC
EILKSTCPEQCSSHGAFNTDSGTCVCEANWTGADCSIEVCVVDCGPHGLCISGACHCEEG
WTGPDCEQRDCHPRCIDHGVCREGKCDCHQGWTGEHCTIEYQVHDALTDGCPGLCNNNGR
CILDQNVWHCICQSGWRGLGCDVATETLCSDGKDNEGDGLVDCMDPDCCTQISCQGQTYC
RGSPDPAAVAGQGQSSSPRPLSKGFYERVGFLIG
Download sequence
Identical sequences G3PW44
ENSGACP00000021833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]