SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021895 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021895
Domain Number 1 Region: 394-698
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 4.94e-46
Family Rhodopsin-like 0.0012
Further Details:      
 
Domain Number 2 Region: 95-377
Classification Level Classification E-value
Superfamily L domain-like 1.17e-43
Family Ngr ectodomain-like 0.0069
Further Details:      
 
Domain Number 3 Region: 23-60
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000825
Family LDL receptor-like module 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021895   Gene: ENSGACG00000016581   Transcript: ENSGACT00000021936
Sequence length 749
Comment pep:known_by_projection group:BROADS1:groupIV:2392871:2421565:1 gene:ENSGACG00000016581 transcript:ENSGACT00000021936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRNLTLAFSALFIGLNVTEDTAACPLGYFPCGNLTMCLPQVLHCNGIDDCGNQADEENCG
DNNGWPHLFDKYFGMPSYNAGTRSNVCLLGVIPELCQCRDLELDCDGAHLVDIPLVPMNV
TMMSLQRNHLQKLKANTFFKYQSLQKPLCGYLQYNRIRDVSPDAFRGLFNLTRLYLSFNK
ITVLMPGVFQDLHKLEWLILENNNIQKISPLTFSGLDSLVLLVMMNNSLAKLDDICREMP
ILNWLDLEANLIETIGNVSFCSCSMLTVLVLQQNRISHIHEQAFSILQKLGELDLSSNRL
VAIPPNLFVLLGDLLQLNISYNPIVELQVNHFDKLHKLKSLSIEGIEIGNIQRRMFEPLQ
YLTHIYFKKFQYCGYAPHVRSCKPNTDGISSFEDLLANIVLRVFVWVVSATTCFGNVFVI
CMRSYVRSENKLHAMCIISLCCADGLMGIYLFMIGAYDLKFRGEYNQHAQAWMDSSECQV
IGSLAMLSTEVSVLLLTYLTLEKYICIVYPFRYLTPGWRRTVTILLGIWLFGFIIAVLPL
ACKGLFRNFYGTNGVCFPLHSEQPETLWAHVYSIVIFLGLNLVAFLIIVLSYASMFYNIQ
RTGTQTTKYSNHIKKEVTIAKRFFSIVITDSLCWIPIFILKILSLLQVEIPGTISSWVVI
FILPINSALNPILYTLTTRPFKETILQVWANYRQKRPLLSGHPAHHPSLTWQEMWPLQEN
SLGDPRWGAFKEKCVASNNVQLKHLKRQE
Download sequence
Identical sequences G3PWA6
69293.ENSGACP00000021895 ENSGACP00000021895 ENSGACP00000021895

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]