SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021967 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021967
Domain Number 1 Region: 283-380
Classification Level Classification E-value
Superfamily Immunoglobulin 1.82e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 2 Region: 448-731
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 5.23e-16
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.044
Further Details:      
 
Domain Number 3 Region: 25-78
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000000388
Family Ovomucoid domain III-like 0.012
Further Details:      
 
Domain Number 4 Region: 204-296
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000197
Family I set domains 0.031
Further Details:      
 
Domain Number 5 Region: 107-200
Classification Level Classification E-value
Superfamily EF-hand 0.0000000194
Family Calmodulin-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021967   Gene: ENSGACG00000016634   Transcript: ENSGACT00000022008
Sequence length 796
Comment pep:known_by_projection group:BROADS1:groupIV:2582164:2682587:-1 gene:ENSGACG00000016634 transcript:ENSGACT00000022008 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGHNGHPSPCEHKYCGLGRHCVADHETGQGECRCLDYCKPHYKPVCGSDGKLYQNHCELH
RASCLRGQKITIMHSEECFYKDDNCRLSDYRRLKTKVLDLHDKRYMGSKFHGAHGDNMAA
RKQLVDVMFRRFDANSNGQIDASELSQKEIYVIKQEGLSKDVSECTLFDLLKYNDVNDDE
HLTKDEFYTALDVYLLTLPDDQKVSVTTATVGQSAVLTCAIAGERRPPVLWKRNHQYLNS
LNLEDINDFGDDGSLYITKVTTTHMGNYTCHADGYEKLFQTHTLQVNVPPIIRVYPESQA
REPGVTASLRCHAEGIPGPRLAWMKNGMDIASKLSKQLTLQANGSEVHISNVHFEDTGAY
TCIARNDAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPVACE
IQRHIKPSEKLLALQEEVCPTSPGEEVQRCVWASAVNVKDKFIYVTQPTLDRVLVVDIQS
QKAVQTVDTDPYPVKLHYDKSHDQVWLLSWGDMEKNRPTLQVINQASGRVSHHTVHTQPI
GRRFDRVDDFFIPASGLITNHIRFGLILHRNEPVLHKIDLETTSYVKNISLREYNCIPKS
VSYTHLGGYYFVDCRPDSTGATRPQLVVDGVTDRVIGQNRDVTGTPYVSPDGRYLVSVDD
GDGLMRIQMISERGEIQEPFDIHTNLHLSDLAFQRSFTEVHQYNVFGSSGRQTDALFVEL
RTGKVKMIKSLKEATKSPEWPWSSRNRPMAGSGLFGQYLMTPSRESLFILDGRLNKLNCE
ITDVVKGNVVVWVGES
Download sequence
Identical sequences G3PWH8
ENSGACP00000021967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]