SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022153 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022153
Domain Number 1 Region: 2630-2751
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.73e-19
Family Growth factor receptor domain 0.0084
Further Details:      
 
Domain Number 2 Region: 3021-3093
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.11e-18
Family TB module/8-cys domain 0.00045
Further Details:      
 
Domain Number 3 Region: 968-1039
Classification Level Classification E-value
Superfamily TB module/8-cys domain 4.05e-18
Family TB module/8-cys domain 0.00082
Further Details:      
 
Domain Number 4 Region: 3135-3264
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.04e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 5 Region: 1043-1173
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.3e-17
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 6 Region: 2535-2665
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.61e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 548-668
Classification Level Classification E-value
Superfamily Growth factor receptor domain 5.65e-17
Family Growth factor receptor domain 0.0066
Further Details:      
 
Domain Number 8 Region: 729-865
Classification Level Classification E-value
Superfamily Growth factor receptor domain 7.53e-17
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 9 Region: 332-399
Classification Level Classification E-value
Superfamily TB module/8-cys domain 2.75e-16
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 10 Region: 185-270
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000122
Family TB module/8-cys domain 0.0015
Further Details:      
 
Domain Number 11 Region: 2739-2803
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000157
Family TB module/8-cys domain 0.00016
Further Details:      
 
Domain Number 12 Region: 2219-2314
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.00000000000000432
Family TB module/8-cys domain 0.0000575
Further Details:      
 
Domain Number 13 Region: 2376-2473
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000124
Family TB module/8-cys domain 0.0013
Further Details:      
 
Domain Number 14 Region: 2911-3023
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000243
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 15 Region: 2000-2134
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000526
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 16 Region: 1217-1340
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000753
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 17 Region: 863-946
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000863
Family TB module/8-cys domain 0.0027
Further Details:      
 
Domain Number 18 Region: 462-587
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000879
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 19 Region: 666-743
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000000981
Family TB module/8-cys domain 0.001
Further Details:      
 
Domain Number 20 Region: 3261-3377
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000298
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 21 Region: 2816-2944
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000298
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 22 Region: 3096-3140
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000232
Family EGF-type module 0.0097
Further Details:      
 
Domain Number 23 Region: 2293-2342
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000343
Family EGF-type module 0.00089
Further Details:      
 
Domain Number 24 Region: 2455-2507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000077
Family EGF-type module 0.0026
Further Details:      
 
Domain Number 25 Region: 2168-2214
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000113
Family EGF-type module 0.00047
Further Details:      
 
Domain Number 26 Region: 1166-1216
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000296
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 27 Region: 2497-2534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000133
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 28 Region: 2127-2175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000145
Family EGF-type module 0.0088
Further Details:      
 
Domain Number 29 Region: 2331-2378
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000327
Family EGF-type module 0.01
Further Details:      
 
Domain Number 30 Region: 290-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000863
Family EGF-type module 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022153
Domain Number - Region: 156-187
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0133
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022153   Gene: ENSGACG00000016773   Transcript: ENSGACT00000022195
Sequence length 3563
Comment pep:known_by_projection group:BROADS1:groupII:18352991:18399386:-1 gene:ENSGACG00000016773 transcript:ENSGACT00000022195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CKRGGRLLQLSVALVALLSLCAELGDAAEVLETEDSGTMSKQTDSRATRAKRRGGSDVLR
GPNVCGSRNNAYCCPGWKTLTGGNQCIVPICRSTCGDGFCSRPNMCTCPNGQIAPSCGSK
SVQHCNVRCMNGGSCAEDNCQCQKGYVGNHCGQPVCENGCLNGGRCVGPNRCVCTYGFTG
AQCERDYRTGPCFASVHNQMCQGQLTGIVCTKTLCCATVGRAWGHPCEMCPAQPQPCRRG
FIPNHRTGACQDVDECQAIPGICEGGNCINTVGSFECKCPAGHKFNEVSQKCDADLDECS
NIPGLCGVGECSNTAGSYFCKCPQGYYTSSDGSRCIDSRGGYCFASLLNGRCANQNSQLV
TKMQCCCDSGRCWSDRSTPEMCPIRGTEEYQKLCFQMPDGRVPGSPDVPGIYPILYPGQT
PGQVPGQVPVFPGQIPIQVPGQGPGPFPGQIPGPGIIQTQNITNMCQAYRTLCQNGRCIP
MPSIGYRCECNMGFKLNDRGECFDADECERSPCAHGDCVNTPGSYICQCPAGFQTTATRT
ECRDLDECVANGRICNNGRCVNTVGSFHCVCNAGFEISGDGKNCQDQDECLIRNMCLNGL
CINDDGSFKCICKPGFLLDTSGRMCVDIDECETPGMCMNGRCVNTEGSFRCECAAGMAVG
LDGRVCVDTHMRSSCYGGYKRGQCVRPLFGAVTKSQCCCASTATGIEFAYGEPCQPCPPQ
SSAEFLALCPSGIGTSVDGRDINECALDPDLCQNGVCENMVRTFKCDCNEGFEVDLTGKN
CVDIDECLMNRLLCENGLCRNTPGSFTCQCPKGYLFDPEADVCTDVDECLSSPCVNGDCR
NSQGSFVCLCSLGSSLDSTGMECIETTKSTCWLKIVNNRCEVNINGATLKSHCCATLGEA
WNSPCAKCEKDPICGKGFARVKGNACEDVDECQVFPGVCINGKCINTPGSFFCQCPPGMT
VDVSGRTCIDLRMEHCYLTHDDERCGAAIPGRQRVDACCCSVGVAWGPECDECPERGTPE
YARLCPRGPGFSHRGDFLNGRPFLKDINECRMINSLCSNGRCRNTVGSFRCRCDNGYALD
SDERNCTDIDECHISPDLCGQGRCVNTFGDFKCECFEGYESGFMMMKNCMDIDECERNPL
LCRGGECVNTEGSFQCMCPEGHEIAPDGSACLDINECDLSDRLCRNGQCVNMVGRYQCSC
DTGYKSTENRLECVDIDECTIENGGCETFCTNSEGSYECSCHSGYALMPDLRSCTDIDEC
EESAEICDGGQCSNTPGTYQCLCFDGFMSSDDVKTCLDVDECDLNSNICLSGNCENTKGS
FICHCDLGFSVRKGTTGCTGVRSCALSANCGEVTVFCPMRASHRTFVYPFVALALRSFKH
YVTVGRVPQLAIADKGSRKPILSDLISGRGNESDTVCSSVSSFRQSRVCSKAAGADSPFW
NFSPRIPRNQDSNSSQAGRMSRYRSAFNTSRLEMGCHCRKASCDHVGMRGRNLCACVSAD
ESDPAVDETPTRVISFFIYSTLRTRNGVFACMFFVLFVLYWTGWRCAGGVYKAGSVLTLK
RGPGRKLNRVNFFLLKLNVKTVERFGQLVCSRNTIFQFKASTIVAFLGRNTCKISLCSFG
IMGLYNMLNMDEVSTCYAYFRAAMRAAVGYQQASRRLGKMCNPLMSLLILVCLSSVKHEP
YSYLQPPLFAFYISTRECESVCVFLCSLSSKVLWEIIFNSVCNPEICLLPALILTPSTKC
FELLPSQRLPHREGRVSSADKLYRKWHTGRSGALDSLHRVVLTPISSRHCGNTKQAFSIV
PCSRWCPNRLSRHCQLLDGDLIGYALQDVNSFMGRKDFNCSQFNCSHTPWPDRIGWPIWR
GTFITAYLSTSIFHPSAEFRYNYNGFAMEKCLFVGLSRQNKALALGYRCPSWPSHTCTMK
MDRLCSLNLCRKAISIGDHGNVSSALKYMDEDSNPERLCPVVSRCSLYAIQTKHQLVPQC
QEPHWTEKADENHQTNRARCYLSLSFISDVNECEIGAHNCDRQATCTNTAGGFKCNCSPG
WIGDGLKCTDLDECSNGTHMCSNNADCLNTMGSYRCACKDGFSGDGFYCSDSDECAENGN
LCENGHCLNLQGGFRCECDMGFVPTPEGKACKDIDECTFADICVHGRCQNIPGLFRCDCN
VGYELDRSGGNCTDINECADPTICINGICVNIPGSYHCNCPPDFELNPTRVGCVADTRSG
SCYLDVRARGDASESLECSREIGVGVSKASCCCSHGAGWGNPCEACPFTNSTEYKTLCPG
GEGFSPNPITVILEDINECRELPGLCQGGQCINTFGSFQCECPRGYALNAETRICEDVNE
CEQKGICGPGQCYNTIGNYTCICPADYMQVNGGNNCMDMRKSFCYRNFYSDNGTCDGELT
FNITKKACCCSYNMGRAWNKPCDRCPLTGTDEFPILCGSDKWGFGIDIITGRIVDIDECR
EIPGVCENGVCINMVGSFRCECPIGFVYNDKLLICEDIDECQNGPVCQQNAACLNLPGSY
RCECKPGYRSSPTGQCLDRNECLENPGVCNPGQCIDFVGGYRCICPNGFKTTRDQSMCVD
VDECERQPCGNGTCKNTVGSYNCLCYPGFQNSHNGDCIDVDECSTQRGMCRNGQCVNAVG
SFLCVCNDGYELTLDGRTCTDINECAVNPGTCGAGTCLNLDGSYRCICPPGYYLHEETCE
ADIDECSQAPEICTFGTCSNTEGSFTCLCPEGFQVSASGRRCLDIRVNSCYTKFENGRCL
APKPQLTSKEECCCTGMPGQGWGDPCEICPTKGEDGYPLLCPNEGYQQGPDDRPKDIDEC
LNDPCINGQCINIDGSFRCECPMGYHLDTSKVQCEDTNECAAGNPCGNGTCNNVIGGFEC
ACEDGFEPGPMMTCEDINECSQNPLLCAFRCVNVVGSYECKCPTGYVLREDKRMCKDQNE
CEDGIDDCASRGMTCKNLIGTYMCICSPGYTRQPGGDGCMDLNECLAKPAVCKNGRCENT
VGSFRCRCDQGFVANPTQTECIDNREGFCFTEVLTTLCQMTSSNRNLVTKSECCCDGGRG
WGTNCELCPLPGTTQYKKMCPLGPGFTTDGRDIDECRVMGNLCKNGQCLNTLGSYTCNCK
PGYSTDISSTQCVDVDECIQAPKPCNFICKNTEGGYLCSCPRGYILQEDGKSCRDLDECS
TKQHNCQFLCVNTIGGFTCKCPAGFTQHHTACIDNNECASDPNLCGSNGACQNTPGSFNC
DCQRGFSLDPNGQACEDMDECDGNHRCQHGCQNLVGGYRCSCPQGYLQHYQWNQCVDENE
CQNSQICGGASCHNTLGSFRCLCPTGFNYEQTGGGCSDVNECSTSHNPCKFGCSNTDGGY
LCGCPAGYFRAGQGHCVTGLGFTGGDSGAGEGGEVDDNSLSPEACYECKINGYPKKGRKR
RSSNSTQEEPQQDVQPAEKEMVSLASVDVEDTLRLHLNVSDLGSRAHILQFTPALSALSD
HVRYSIDYGNEGGYFKINQREGVSYLHLSKKKALPPGAYSLQISSVPLYREEELAALEDR
HDKDYLTGQLGDVLKMRVQIVLH
Download sequence
Identical sequences G3PX14
ENSGACP00000022153 ENSGACP00000022153 69293.ENSGACP00000022153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]