SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022269 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022269
Domain Number 1 Region: 317-476
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.8e-56
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000284
Further Details:      
 
Domain Number 2 Region: 149-309
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.26e-46
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0000476
Further Details:      
 
Domain Number 3 Region: 112-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000232
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 66-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000439
Family EGF-type module 0.0082
Further Details:      
 
Domain Number 5 Region: 25-64
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000214
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022269   Gene: ENSGACG00000016860   Transcript: ENSGACT00000022311
Sequence length 477
Comment pep:known_by_projection group:BROADS1:groupII:18517790:18526082:-1 gene:ENSGACG00000016860 transcript:ENSGACT00000022311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRRGNVLTATLTTLTLLLCLRSVRGDYCQVNVCHNGGTCVTGIGEDPFICICTDGFAGD
TCNLTETGPCSPNPCKNDGSCKIVAPTRRGDVFNEYVCKCQPGFEGAHCQTNVNDCANKP
CKNGAVCRDLDGDYACQCPSPYVGKQCQLSCISLLGMEGGAIVESQISASSLHYGILGLQ
RWGPELARLNNQGLVNAWTSAAHDRNPWIENNMQKKMRLTGIITQGASRMGASEYVKAFK
VASGFDGSAYTAYRAEGQRRDKVFIGNADNDGTKTNLFDPPIVAQYIRIIPVVCRRACTL
RLELVGCELNVYSNTSGCSGPLGMRSRLVSDGQLSASSAFRTWGIDTFTWHPHFARLDKQ
GKTNAWSPANNNRSEWIQVDLEKTKRLTGIITQGAKDFGVVQFVTVFKVAYSNDGESWSA
VKQENSGKDKLFQGNVDNNTHKKNLFEPPFYARYVRVVPWEWHERVTLRMELLGCDD
Download sequence
Identical sequences G3PXD0
69293.ENSGACP00000022269 ENSGACP00000022269 ENSGACP00000022269

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]