SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022303 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022303
Domain Number 1 Region: 3822-4024
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.81e-30
Family Laminin G-like module 0.0043
Further Details:      
 
Domain Number 2 Region: 3123-3226
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-30
Family Cadherin 0.00063
Further Details:      
 
Domain Number 3 Region: 3333-3444
Classification Level Classification E-value
Superfamily Cadherin-like 2e-29
Family Cadherin 0.00078
Further Details:      
 
Domain Number 4 Region: 3227-3332
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-29
Family Cadherin 0.00061
Further Details:      
 
Domain Number 5 Region: 1127-1256
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-29
Family Cadherin 0.0009
Further Details:      
 
Domain Number 6 Region: 922-1025
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-27
Family Cadherin 0.0015
Further Details:      
 
Domain Number 7 Region: 3022-3130
Classification Level Classification E-value
Superfamily Cadherin-like 5e-27
Family Cadherin 0.0012
Further Details:      
 
Domain Number 8 Region: 1559-1660
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-27
Family Cadherin 0.00069
Further Details:      
 
Domain Number 9 Region: 2805-2914
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-26
Family Cadherin 0.00042
Further Details:      
 
Domain Number 10 Region: 1020-1138
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-26
Family Cadherin 0.00051
Further Details:      
 
Domain Number 11 Region: 2281-2385
Classification Level Classification E-value
Superfamily Cadherin-like 7e-26
Family Cadherin 0.00056
Further Details:      
 
Domain Number 12 Region: 137-259
Classification Level Classification E-value
Superfamily Cadherin-like 7e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 13 Region: 1762-1882
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-25
Family Cadherin 0.0009
Further Details:      
 
Domain Number 14 Region: 2587-2722
Classification Level Classification E-value
Superfamily Cadherin-like 9.14e-25
Family Cadherin 0.0017
Further Details:      
 
Domain Number 15 Region: 816-919
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-24
Family Cadherin 0.00041
Further Details:      
 
Domain Number 16 Region: 456-559
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-24
Family Cadherin 0.00082
Further Details:      
 
Domain Number 17 Region: 1453-1557
Classification Level Classification E-value
Superfamily Cadherin-like 5.85e-23
Family Cadherin 0.001
Further Details:      
 
Domain Number 18 Region: 3437-3541
Classification Level Classification E-value
Superfamily Cadherin-like 5.28e-22
Family Cadherin 0.0015
Further Details:      
 
Domain Number 19 Region: 2072-2179
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-22
Family Cadherin 0.0011
Further Details:      
 
Domain Number 20 Region: 2179-2286
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-22
Family Cadherin 0.0014
Further Details:      
 
Domain Number 21 Region: 2916-3028
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-21
Family Cadherin 0.0017
Further Details:      
 
Domain Number 22 Region: 709-814
Classification Level Classification E-value
Superfamily Cadherin-like 1.16e-20
Family Cadherin 0.0012
Further Details:      
 
Domain Number 23 Region: 1664-1785
Classification Level Classification E-value
Superfamily Cadherin-like 3.43e-20
Family Cadherin 0.00093
Further Details:      
 
Domain Number 24 Region: 2387-2495
Classification Level Classification E-value
Superfamily Cadherin-like 9.28e-20
Family Cadherin 0.0018
Further Details:      
 
Domain Number 25 Region: 2489-2599
Classification Level Classification E-value
Superfamily Cadherin-like 2.71e-18
Family Cadherin 0.0024
Further Details:      
 
Domain Number 26 Region: 1233-1347
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-17
Family Cadherin 0.0039
Further Details:      
 
Domain Number 27 Region: 1875-1973
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-17
Family Cadherin 0.0022
Further Details:      
 
Domain Number 28 Region: 1360-1459
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000101
Family Cadherin 0.0028
Further Details:      
 
Domain Number 29 Region: 562-663
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000000328
Family Cadherin 0.0021
Further Details:      
 
Domain Number 30 Region: 1981-2084
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000186
Family Cadherin 0.0022
Further Details:      
 
Domain Number 31 Region: 2703-2812
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000006
Family Cadherin 0.0051
Further Details:      
 
Domain Number 32 Region: 364-463
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000000428
Family Cadherin 0.003
Further Details:      
 
Domain Number 33 Region: 4138-4177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000583
Family EGF-type module 0.0065
Further Details:      
 
Domain Number 34 Region: 33-149
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000101
Family Cadherin 0.0038
Further Details:      
 
Domain Number 35 Region: 4050-4175
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000643
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 36 Region: 3546-3642
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000343
Family Cadherin 0.0069
Further Details:      
 
Domain Number 37 Region: 273-355
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000127
Family Cadherin 0.0084
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022303
Domain Number - Region: 4026-4061
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000195
Family EGF-type module 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022303   Gene: ENSGACG00000016881   Transcript: ENSGACT00000022345
Sequence length 4598
Comment pep:known_by_projection group:BROADS1:groupIX:5649105:5707283:-1 gene:ENSGACG00000016881 transcript:ENSGACT00000022345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKLLVSLLVLLLLQQLCGCAGNQRMTRAASMQFTHSVYNATIYENSAAKTYLESHAKMG
IYVTDPAWEIRYKIISGDNENLFKAEDYLLGDFSFLRIRTKGGSTAILNREVKDHYVLTV
KASERGTDFECRAKVKVQVQDTNDLRPLFSPTSYSISLPENTAMRTSVAKVTATDADIGT
NGEYYYSFRESTDMFAVHPTSGVVTLTGKLDFSEKKLYELEILAVDRGMKLYGSSGFSSM
AKLTVRVEQANEHAPVITAVTLAPSGVDHDPTYAIVTVEDGDQGQNGEIASLSIVAGDPL
QQFKAVRSSPGSKEYKIKAVKDVDWDSQPFGYNLTLQAKDKGSPPQFSSVKLVHVTSAHF
KAGPPIFEKAVYRVNLSEFAPLLTPVTMVTALPHYPQLKYAFKHKSDKNKFTINPDTGLI
STAGPINADFTPRFELDVITVDKKAAAKVIVDVIDVNNNAPEFEQTSYAASVDENVPAGT
SVVAVKATDLDRGENGYVTYSITNVSPQPFVIDYFSGVVSTSEVLDYELMPRIYNLKVRA
SDWGSPYRREVEASVTITLNNLNDNKPLFENVDCEVTVPRDHGEGEQITTVSAIDADELQ
LVRYHIKAGNELDLFELNPNSGVLSLKRTLGEGEAAKVSSHSLQVIATDGEHETRPMTMN
ITVITARKPVQLKCVETGVATLLAEKLLQGSRIHMQTEPDDNLMDFHTVNRAAPQFAESF
PSVVEVKEDLPVGARIVHLSATDSDSAFNGKLVYVISGGDTESRFNVEMETGWLLVYSPL
DRETTDQYTLNITVYDLGIPQKSSSRLLGVKIRDANDNSPKFLQDSYSVDIGEGTAVGTD
IIQVDSTDRDQGDNGVVKYSILGGTDHFAIHEKTGVVTVTRPLDRELHPVYLLKIAARDQ
AANEPQLVSTVPLKITLEDVNDNPPKFVPPNYRVKVREDLPVGTVIMWLEAHDPDIGPSS
QVRYSLTDNGDGNFEVDKLSGAVRILQSLDYETKQVYNLTAKAKDKGKPMSLSSTCFVEV
DVVDVNENLYRPLFRSFVEKGFIKEDALVGTSVMTVSAEDEDEGRDGEIRYSIREGSGLG
IFTIDEETGVIRTQELLDHETTSHYWLTVYAMDRGVVPLSASVEVYVQVLDVNDNAPQTS
EPVYYPSVMESSPKDVSIIQINAVDPDAKASDKLTYRITSGNPQGFFAVNAKTGLVTTTS
RKLDREQQDEHILEITVTDQGVPAKSTTVRVIVRVLDENDNRPLFLEKIYKIKLPEREKP
EKERAAKRDPVYRVIASDRDQGANAEISYSIEDGDDNGKFFIEPKTGLVSSKKFSSAGEY
DILTIKAVDNGRPQKSSTCRLHIEWIQKPKLPADAALLLFEESPFTFSVMESDPVAHMVG
VIATEASDVDVWFEITAGGNYDSRFDVGKASGTLIVARPLDAEQKSNYNLTVEATDGTRT
VSTQVLIRVIDTNNHRPEFSQQVYEVNVPEDKPAGTEVLQISASDRDEKNKLTFTLLSST
DPFSLRKFRLDPGTGTLYTAERLDHETMHRHVLTVMVRDQDIPVKRNLVRVIVNVDDTND
NTPWFISTPYSGRVFESAAVGAVVLQVTALDKDKGDNAAIVYSIESGNVANSFSIDPVLG
TIAVAKELDRNSKNAFDLTVKASDSGLPPLSTTAAVRIAVTVSDNAVPRFTEREFSAEVS
ESVHPGSFVSMVTADSQSSIFYQIKGGNINNAFDVNPNSGVVVTQKALDYEAASQYKLVI
QGTNMAGLASNATLLIHVKDENDNAPIFLQREFKGAVSESAPVNSVVLTRENTPFVVRAT
DADCGQNAMLVYQIVEPFAHNYFAIDSSTGAIRITTAFDYEQKSVFRFTVQVHDLGMPRL
FAETPANVTVEVIDVNDCPPVFSQEQYEAAVIVPTFKGVEVIKVNAVDADSGPNSKLLFS
ISEGNIGDKFQIDPITGIISILNVTQLRSRYEIKVRVSDGRFAAVATVKIHVKENKESKL
KFTRESYKARVRENLSEEKTLAVIAAVGTQVNEPLFYKILNPDSRFKISQTSGVISTTGI
PFDREAQDTFDIVVEVTREGNSEDRAHVLVTVTVEDVNDNKPMFVNLPYHALVQMDAEEG
QVIRQVTAVDKDSGANADLRYLLKNHQEHFQINPSGAISLKKKFDTDSLNTDFVVVVMAT
DNGEVALSAEVEVPITVVNKAMPVFEKPFYSIEIPENIQLHTPVLHVQANDSEGPRIVYT
ISEGDPFKQFSIDFNTGVIHVIQHLDFETHPAYKLNVRATDSLTGAHSEVFVDIILEDVN
DNAPKFLSTAYYANISEASVIGTFVLQVDAKDSDTGNNQEVFFQLVVEKGKNSNVFTIGR
DTGVISTAQPLDHEETQQHKLRVRVLDGGVPSLSSDVVVTIDVTDLNDNAPLFTQHTYKT
TISELAPRGYFITQVQASDADSSDANKLEFSIISGNDDQNFSIDKRTGAVAVSNHRRPHM
QPFYNLNVSVSDGVFRSSALVAVTVTGANFHNPTFSQADYVVELVENSPIGTLVAEAKAT
DDDEGIYGQITYLIVNDFAKDKFSINGDGEILTLESLDRENTVEKVIPISLIAKDGGGKV
AFSVVNVILTDVNDNAPQFRAADYKATIASDVPRGTSVVRIAASDMDEGSNADIEYSIEA
DAENVEENFEIHSASGVVTTKESLIGLENELYAFFVRAKDTGNPPKHSVVQVYIRIVAPE
TPVPKFAESHYRYTIPEDLPIGAEIDVLHAESEQPVVYSLAKGNTAESNEDEVFVVDRDS
GALKLQKSLDHETTKWYQLTLLSQTNHENYEIVTSVSVNIQVKDMNDNEPVFESDPYEAV
IVENLPSGTQVIQVKATDQDSGTNGHVVYSLDPKLNSREISELFAVNGESGWVTTLKELD
REKTHRYTIAVVATDQGDRVQHTNGTRVEVTVADVNDSPPRFTAEVYKGTVSEDDPPPSG
VIAILSTTDDDSEDINKHVNYFITGGDPLGQFAIEHIQNEWKVSVRKPLDREEKDNYLLN
ITASDGIFTAKAVVEVKVLDANDNSPVCQKSLYSERVPEDSPAGRLVLQVSATDADIRSN
AQISYELQGAGSELFIIDSDTGELKTSQPLDREEQDEHRFKVRAVDGGGRYCEADVHIGV
EDVNDNPPQFSSDPYTVTVFENTETGTYVAKLLANDMDSGLNSDILYSLVNSADGSFSID
ERSGVISLERPLDREAQSTYELRARASDQGSPRLSSLCQVLISVLDINDNPPVFEHREYT
ATVPEDVAAGSQLLRVQAASRDTEAGGEISYGIISGNEHGMFSVDPRTGDVFVIEPLDYE
VSHEYYITVEATDGGSPPLSDMATVNINLTDVNDNRPVFSQDVYTAVVGEDAELGKTVMA
VVAEDLDGPSFDHVRYSIVDGNQGSPFTIDPVRGELKVARQLDREQTSGYTLTVVASDNG
SPPLSSSAVINVDISDVNDNPPLFSQANYSLIIQENRPKGTSVLQLTVTDRDASHNGPPF
TFAIADGNVGDAFHINQQGALVAAGALNRKTREHYLLRAQVSDSGKPPRHSAAFVSVRII
EESVYPPAILPLDIYVTTAGDEYPGGVLGKIHATDQDIYDTLAYSLAPPPSAASDDSAAL
FSVSASDGKVVALRPLDVGHYSLNVTVTDGRLTAAADVTVHVRQATRQALDNSIAVRFAN
IAPEEFIGDYWRNFQRALRNIAGVRRSEVQLVSLQPSEQGDLDVLLALERSGSPYQSQEV
VFHKLNSSAAVIEEMTGVRIARVVQKLCAGLDCPLSFCDEVVSLDKTAVATYSTARLSFV
TPRHLRTATCQCEGGRCPVQNNLCENDPCPEGTECVADPREAVYSCVCPEGKKGKCSDGH
SLTFSGSGYVKYRLMENENKELMKLSLRLRTFSSHATHVRQRHRLQHPRIVNGRLQYKFD
CGSGPGLVSVHSAQVNDGEWHALTLEVDGNYAKLVLDRVHAASGTAPGTLRTLNLDNTVY
FGGHVRQLAAARHGRSLPVTSGLRGCLEAIALNGQELPLNTKARRAHAALEDIVDVSPGC
ALAPAETCSSNPCTNGGSCTSLPNGGYFCKCPASFMGTHCEIGISPCASNPCLYGGTCVP
RTDDFYCQCRGQYSGQRCQLGPYCRDNPCQNSGKCIDSLDGPVCECESGFQGDRCLSDID
ECIKSPCANGGQCQNTYGAYRCNCSLGFNGQTCELRAEVRNDFVSTSWNIGLEEVIGIVV
FVASIFILVLLFVVIRKKACRRKSRTGHGDKHLGGSSAPHSFLQRPYFDIKLSKNIYSDI
PPQVPVRPISYTPSIPSDSRNNLDRNSFEGSAIPEHPEFSTFNPDHGHRKTVAVCSVAPN
LPPPPPSNSVSDSDSIQKPNWDYDYDTKVVDLDPCLSKKPVEDSACPYNTRGSMSEVQSL
SSFQSESCDDNGYHWDTSDWMPSVQLPGIQEFPQYEVVESPAPLYSDPSAIDTDYYPGGF
DIENDFPPPPQDFPAGDDLPPPPEYGDTLRPAGRGFDPLPQLYSLNQYLPQHPYPSEGAD
GEGRGGAASALGDATPASTMGGGGGYRGGYPLGCGRDFDSSALDNMSMSLYTSTASCSDM
SACCEESEAMISDYESGDEGHFEQLAIPALDSQQHTEV
Download sequence
Identical sequences G3PXG4
ENSGACP00000022303 ENSGACP00000022303 69293.ENSGACP00000022303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]