SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022393 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022393
Domain Number 1 Region: 693-750
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000486
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1-40
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000418
Family Somatomedin B domain 0.0037
Further Details:      
 
Domain Number 3 Region: 35-107
Classification Level Classification E-value
Superfamily E set domains 0.000091
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022393   Gene: ENSGACG00000016950   Transcript: ENSGACT00000022435
Sequence length 792
Comment pep:known_by_projection group:BROADS1:groupXIV:6510961:6517608:-1 gene:ENSGACG00000016950 transcript:ENSGACT00000022435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TCEGSCGYKFDSCSCRSTCVALKNCCTDYREYCVEVFPYSGSILGGTDLIVLKAIFNKSS
ELLCRFNSNIDTVGYVDEGGQGHCISPLLYQTGWVSLHISSDNGTTFNRVGTWLSVHTGK
LDAKFKAILVNSTKWQYYGTPAVGGSLEMTWNTSLVRAERVNVELWGYRETGKPYANDWQ
GEWQYLYSLAKNQLNNGSFSFLPKPAQSGFSSWEVGALRVSSSNNSDGRWDVQAAWTEDH
ALAWHLEDKFRQNSTVWALEKCLAWDQLENELPNFLSEIIDCPCTLAQARADTGRFHTDY
GCDIEKGSVCTYHPGSVHCVRAIQASPKYAAGQQCCYDATGTQVLTGDSIGGSTPDRAHD
WGSSPFLRPPRVPGQSHWVYDVLSFYYCCLWSDNCHYYFKHRPSSDCRRYRPPSSVTTAV
VFGDPHFVTFDGVRYSFNGKGEYTLMTSAKTQLTIQGRTEPVNTTIKATKLTAVAMKETS
SDVVEVRLVSGHSGLEVLQNQKTLSFAEQSWMDLQGVSVFSPTSRNVTVMFPSGAGVEVR
LRGETVTTTVLLPEEFNDSTLGLLGKMNGDAKDDLALSNGELVRNLSNPEEVFGFGASWA
ISNESALFTYDSEILLNTYYYVSRHDNSFVPVFSVPKSPDDPLANQTYEICTGEGAEYCR
YDILVGRSPRMGNATKVSFQSHVSLAEDLKQVISCGWLGPPNNGKKQGTRYLQGATVHLS
CNEGFTLKGSAERKCLRNGSWSGNDTTCVVPSNIAGIVVGSVVGALALILIITMIVLYSR
KQKRNFYQWLFP
Download sequence
Identical sequences G3PXQ4
69293.ENSGACP00000022393 ENSGACP00000022393 ENSGACP00000022393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]