SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022444 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022444
Domain Number 1 Region: 102-268
Classification Level Classification E-value
Superfamily C-type lectin-like 5.6e-20
Family C-type lectin domain 0.0024
Further Details:      
 
Domain Number 2 Region: 40-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000034
Family LDL receptor-like module 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022444
Domain Number - Region: 262-327
Classification Level Classification E-value
Superfamily FnI-like domain 0.000921
Family VWC domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022444   Gene: ENSGACG00000016993   Transcript: ENSGACT00000022486
Sequence length 540
Comment pep:known_by_projection group:BROADS1:groupXIV:6592672:6603382:1 gene:ENSGACG00000016993 transcript:ENSGACT00000022486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPKADSSSFVLFSLLFVLASGDPPRTGPRLSLARLLSALAAPGQFACRSGKMQCIPMSW
QCDGWTACEDKSDEMDCPPNKEERFRFGNGHDQVEDVIGVAAPVRFNKKCPSGWHHYEKT
ASCYKVYLMNENYWQAVDTCQKVNGSLATFVTNEELQFILKIEVDFDDKVCERRDQCKFW
VGYQYVITNQNHSLEGRWEVAYKGSMQVFLPPEGLAKLGDASPTQDNVFCAQLQRFQIKS
MNERGLHSWHAENCYKKFPFLCKRRQTCVDIKDNVVNEGYYFTPKGDDPCLSCTCHEGEP
EMCVAALCERPQGCQHFRKDPKECCKFTCLDPDGNSLFDSMASGMRLIVSCISSFLILSL
LLFMVHRLRQRRRERIETLIGGNLHHFNLGRRVPGFDYGPDAFGTGLTPLHLSDDGEGGA
FHFQEPPPPYAAYKYPDIQHPDDPPPPYEASINPDSLLYVGLGRHGVSLIPSQMNAMVDG
LQAAVPNTCGGPAAVPAPPPQEREDSIDSSTLLVGPDTPTDGHAPSAVTPDCVSSLSTVV
Download sequence
Identical sequences G3PXV5
69293.ENSGACP00000022444 ENSGACP00000022444 ENSGACP00000022444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]