SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022592 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022592
Domain Number 1 Region: 425-681
Classification Level Classification E-value
Superfamily YWTD domain 3.53e-62
Family YWTD domain 0.000000781
Further Details:      
 
Domain Number 2 Region: 727-984
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-56
Family YWTD domain 0.00000158
Further Details:      
 
Domain Number 3 Region: 1034-1289
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-51
Family YWTD domain 0.00000578
Further Details:      
 
Domain Number 4 Region: 1339-1511
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-34
Family YWTD domain 0.0000118
Further Details:      
 
Domain Number 5 Region: 342-417,673-720
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000152
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number 6 Region: 248-288
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000589
Family LDL receptor-like module 0.00065
Further Details:      
 
Domain Number 7 Region: 131-168
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.0007
Further Details:      
 
Domain Number 8 Region: 50-89
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000275
Family LDL receptor-like module 0.00078
Further Details:      
 
Domain Number 9 Region: 213-250
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000432
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 10 Region: 294-330
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000128
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 11 Region: 171-209
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000419
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 12 Region: 92-126
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000733
Family LDL receptor-like module 0.00094
Further Details:      
 
Domain Number 13 Region: 1293-1339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000147
Family EGF-type module 0.011
Further Details:      
 
Domain Number 14 Region: 10-52
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000106
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 15 Region: 987-1029
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000124
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022592   Gene: ENSGACG00000017100   Transcript: ENSGACT00000022635
Sequence length 1512
Comment pep:known_by_projection group:BROADS1:groupII:20291398:20319980:-1 gene:ENSGACG00000017100 transcript:ENSGACT00000022635 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGARGSAECLCGRNHFTCAVSAFGECTCIPAQWQCDGDNDCGDHSDEDGCMLPTCSPLDF
HCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFHCLNGYCIRSLWHCDGDNDCG
DNSDEQCDKRKCSDKEFRCTDGSCIAEHWYCDGDTDCKDGSDEENCPSDVMAATCSVEEF
QCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSVEFMCSSGMCINAGWRCDGEFDC
DDQSDEKNCTTSMCTAEQFRCGTGRCVRLSWRCDGEPDCSDRSDEEGCEKTESPPCAPDQ
FQCGNGRCIGQRKVCNEANDCGDGTDEHPHHDCRPRSSEGNCNQNNGGCSQKCQMVRGLV
QCTCHTGYRLMDDGKACQDVDECAEEGYCSQGCTNTEGGFQCWCVQGYEVRPDKRSCKAL
GPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENAIALDFHHSHELVFWSDVTLDRIMKAN
LNGSNVQEVVSTGLESPGGLAIDWIHDKLYWTDSGTSRIEVANLEGTHRKVLLWQNMEKP
RAIALHPIEGKIYWTDWGNTPRIEYSNMDGSNRRVIADTHLFWPNGLTIDYAGRRMYWVD
AKHHVIERADLDGRNRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEI
IRNKLHFPMDIHTLHPQRQPAGRNRCGANNGGCSHLCLPSNKTHTCACPTGFKKVDHSNC
ANGLDKFLLFARRTDIRRVSFDTEDMSDDVIPLADVRNALALDWDAKDGYIYWTDVTTDS
INRALWNGSGQEVVVDTSLESPAGLAIDWLTNKLYWTDAGTDRIEVSNADGSMRTVLIWE
NLDRPRDIVVDPIGGFMYWTDWGANPKIERAGMDASSRIVIISSNLTWPNGLAIDYETRR
LYWADAGMKTIEFGNFDGSDRRVLIGSQLPHPFGLTVHEDKLYWTDWQSKSIQSADKLTG
LGRRTLAENLENLMDIHMFHRHRQTVRNPCALNNGGCSHLCLLAPAPKASSCACPTGINL
QTDGKTCTPGMSSFLIFARRTDIRMVSLDIPYFADVVLAVNNSMKNTIAIGVDPKEGKVY
WSDSTLKKISRSDINGKAQEEIVSTGLVTTDGLAVDAVGRKIYWTDTGTNRIEVANLDGS
MRKVLVWQNLDSPRAIALYNEMGYMYWSDWGEHAKLERSAMDGSDRAVLISNNLGWPNGL
AIDMAGSQLLWADAHTERIEAADLNGQNRRTLVTPVQHPYGLTLLGPHIYWTDWQSRSIQ
RADKNTGTNTITVRANLPGLMDIQAVDRERPLGFNRCGGRNESCTHLCLPRPSGTSCACP
TGILLKEDERSCEDSPESYLLFSNRVSVRRISLDTDDHTDVHVQVPELHNVISLDYDSVD
AKLYYTDVTLDVIRRANLDGSGMETVISQGLKTTDGLAIDWVSRNMYWTDTGRNTIEVAR
LDGTSRKVLVNNSLDEPRAIAVFPSKGFLFWTDWGHIAKIERSHLDGSDRKVLINTDLGW
PNGLTLDYDTRR
Download sequence
Identical sequences G3PYA2
ENSGACP00000022592 69293.ENSGACP00000022592 ENSGACP00000022592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]