SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022655 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022655
Domain Number 1 Region: 17-276,303-332
Classification Level Classification E-value
Superfamily DNase I-like 3.93e-69
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.000011
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000022655
Domain Number - Region: 359-413
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.0471
Family NadC N-terminal domain-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022655   Gene: ENSGACG00000017154   Transcript: ENSGACT00000022698
Sequence length 455
Comment pep:known_by_projection group:BROADS1:groupXIV:6911463:6914590:1 gene:ENSGACG00000017154 transcript:ENSGACT00000022698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPRIQHVALLLFLISHRVYIVTWNVGSAVPPDDITSLFGPNVSDGSVDMFVIGLQEVNSM
INKRLKDVIFSDQWSELCMDRLSPFGYVLVASQRMQGVLLLVFSKFCHLPFLRGVQTEST
RTGLGGYWGNKGGVSARMTVFGHPVCFLNCHLPAHMRNLEQRMEDFESILQQQQFEGGTA
TGVLDHDVVFWFGDLNFRIEDYDIHVVKCAIDSNKLPLLLERDQLNMAKNTESILEGFIE
GPLKFPPTYKFDVGTHTYDTSAKKRKPAWTDRILWRPRRTGSPVPTHNAALQRGLTSWLG
GSTKVTQHVYRSHMGFTISDHKPVSAVFSLHFPFRVDMPLVELQVNKEWCKISDATVRFT
VALTYQRSSWDWVAIYKVGFRHHKDYQAYIWAKGEHATQLSFLPQVTFSEEDLPRDDCEY
MLGYYSNNMNSIVGLSTPIQVLPHQTGKTSLKEKN
Download sequence
Identical sequences G3PYG5
ENSGACP00000022655 69293.ENSGACP00000022655 ENSGACP00000022655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]