SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022686 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022686
Domain Number 1 Region: 388-709
Classification Level Classification E-value
Superfamily DNase I-like 6.81e-56
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.0000731
Further Details:      
 
Domain Number 2 Region: 3-103
Classification Level Classification E-value
Superfamily SH2 domain 1.12e-25
Family SH2 domain 0.00014
Further Details:      
 
Domain Number 3 Region: 1160-1217
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.000000000000141
Family SAM (sterile alpha motif) domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022686   Gene: ENSGACG00000017174   Transcript: ENSGACT00000022729
Sequence length 1222
Comment pep:known_by_projection group:BROADS1:groupIV:5751659:5763226:1 gene:ENSGACG00000017174 transcript:ENSGACT00000022729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATAAWYHRDISRVRAEDLLARAGRDGSYLVRDSESVPGAYALCLLFQRHVHTYRILPDA
DGHLAVQTTQGAQVSCFRTLEDLVLGYQHPHKGLVTPLLHAVARDADGGEESSGTDDEKQ
PPGPSSVHAVPSAAPPAKPAPHGLFLDALRERHTSSFYAVGSAAGDVIDLLNDYLFSELP
LDIENVHQGATTLSHLKRTLGTACQGLNSEIDVTLSSLETLAKVFDHPSCSLTHTKKQNK
GPEMDIDSLLCKVSALVSLLSSLEKKVLQALQDAVTNHNLAVQPNPAPPEPAPVKNHAGQ
LPVHSFQVKMVRYGRQTVSVDVDAGVLLFDKKSGSFGVERVSHDRILQIVTFQSSPAKLR
MMVDSRHTPPREMTFESARKRDAFCRLLQLTKTRHSQLREPDVISVFVGTWNMGGSPPPR
SLRSWVTCCGLGHTPDESTASLPHDIYAYGTQENPQGEREWTEHIKATLRSSTHIDFRQV
AVQSLWNMRLAVFVKPEHEGRVSHVHTASVKTGLGNTLGNKGAVGISLLFNGTSFGFVNC
HLTSGSEKVLRRNQNFVDVLRLLSLGDKQLGAFDISLRFTHLLWCGDLNYRLDLDVQDIL
KHVSRREFEELMCADQLTRERHKRKAFLNFKEEKIAFPPTYRYERGSRDCYLWQKYKTSG
VRVNVPSWCDRILWKSYPETHVLCTAYGCTDDIFTSDHSPVFATFQVGVTSRLGDTHAGV
EKAWIELEGIEAIVKTASKAKFFIDFHSSCLEETRRSSENDSQRCDVPGFPKLGWSFKQL
PKLLPIMSDMEYLQDQHLLLSVKSCDGFESYGECCVALRSLTGASEQFETCLSHRGEEMG
SIRGRVRVHVPKDRRGTREKTYEWFYFEKDGKGPERGQIKSPASTGAPINRTVAAPGKPT
PSSYTNPAYFIFEGVSVPRRVEEALPQRRDSLVIWSGNEALQLPKISARKEFDRGPCRRS
DFAEIEIPVVLPQYAPANNVHSPHTGSSYQLFPAKDPSPAPPTSSDATSLYQDQTSHTRD
KYQGGKKIVDDSVLPEKNLRNLYMNHTAIIREKARRLLPERTKPVWAAEAPSAVPYVPAQ
SPHSQVSVPWMGDQQLPGPSGDNSLTALQMAKSLSEVDFFPPVQRVPSIPDHRPSYRNGP
TLHGDRGYSWEKEVSVLQGAPETVRELLSALGLQKYTLGLSLNGWDDLDYFSGITEEDLR
AAGVTNPSHRRRILENLPSNWN
Download sequence
Identical sequences G3PYJ6
ENSGACP00000022686 ENSGACP00000022686 69293.ENSGACP00000022686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]