SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022769 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022769
Domain Number 1 Region: 188-320
Classification Level Classification E-value
Superfamily C-type lectin-like 1.08e-44
Family C-type lectin domain 0.00000101
Further Details:      
 
Domain Number 2 Region: 316-376
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000432
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 149-191
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000184
Family EGF-type module 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022769   Gene: ENSGACG00000017240   Transcript: ENSGACT00000022812
Sequence length 379
Comment pep:known_by_projection group:BROADS1:groupII:21408081:21412155:1 gene:ENSGACG00000017240 transcript:ENSGACT00000022812 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEGSSSSRSFHSGSGDTHRFTTSGSADSSGDAPHVVLPSPSSDWAATESTTPPEETLSGG
ELTQTPGDIHGTPSPVLAPAGLAAPPTASTPASVQTPGAAEGTDSVEGGLNPCNPNPCGA
ALCTVEEGVALCPALLCVSSFHCVQCSLDVDVCHPNPCANGATCVEGADSYKCLCLPSYG
GERCEIDEQRCEDGWTKFQGNCYLHFSDREVWLDAEQRCRDLGGHLVSIITPEEQDFVNS
NAQDYQWIGLNDKTVDNDFRWTDGTPLQFENWRPNQPDNYFDSGEDCVVMIWHESGQWND
VPCNYHLPFTCKKGPVSCGAPPEVENARMFGNRREEYPVNSIIRYQCGPGFTQRRPPTVR
CKADGRWEEPRVQCTDGEA
Download sequence
Identical sequences G3PYS9
69293.ENSGACP00000022769 ENSGACP00000022769 ENSGACP00000022769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]