SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022912 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022912
Domain Number 1 Region: 103-164
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000011
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 249-307
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000653
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 3 Region: 51-118
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000556
Family Complement control module/SCR domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022912   Gene: ENSGACG00000017346   Transcript: ENSGACT00000022955
Sequence length 451
Comment pep:known_by_projection group:BROADS1:groupIV:6441699:6447156:1 gene:ENSGACG00000017346 transcript:ENSGACT00000022955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIVNVFVALFVLYFTAGSGTTEYDQYDDFVEEDYGPQLDYQHPNWCHSPGLTNGEVTCRS
PRGPAFRSTLGTRCEMSCDRGYRLLGRTSIQCLANRRWSGTAYCRKVRCHLLQLIPHGRY
TCTQGFVVDSRCDFTCDPGYRIAGQHSRTCQRSGSWSDAQPECEDTDPPKIKCPPSRLKA
AEPGKLTATVTWNPPTATDTADKSLNVILVGQEPGTDFEEGASIIQYKVYDQARNRAACK
FIVRVEVRRCPVLAAPQRGFLTCSSDGNNYGATCEHHCERGYERRGPSSRVCQFDRSWEG
SLVECVPMEIKSDVRTLSDLLNQFYEKRRLLIVSAPNISDPDYQLQNTMIQKSDCGLDLR
RVTVIELWGSPPGETGRIKEGLLSSEAIQGLRQVFKISRFHFSMLLLDELGLDRERFITP
QASHELFYYIDSFLLDEEERGRLELQRDFCG
Download sequence
Identical sequences G3PZ72
ENSGACP00000022912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]