SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022952 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022952
Domain Number 1 Region: 173-505
Classification Level Classification E-value
Superfamily DNase I-like 2.62e-72
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.00000183
Further Details:      
 
Domain Number 2 Region: 623-639,678-838
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.87e-34
Family BCR-homology GTPase activation domain (BH-domain) 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022952   Gene: ENSGACG00000017367   Transcript: ENSGACT00000022995
Sequence length 848
Comment pep:known_by_projection group:BROADS1:groupIV:6594255:6606952:-1 gene:ENSGACG00000017367 transcript:ENSGACT00000022995 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPINGHFEIVREAEEALLINLSVASGVRIRISGERAPQLLLELQDDDRTQTFLAQVMSAQ
QQGNVQEHRASTQKASTITTLEKNLVQSLASDFGFEDNFNHALKVEEKKNHQNRIVAVRE
PPPVPPLPPRKASYAPSNPLPAAPIPKDRAVSLQTRDHSKPDQAGQREYLVKHLLGKKEK
EYVDIKTFKFFTGTWNVNGQAPDSSLVPWLCCDTEPPDIYALGFQELDLSTEAFFYMDSS
KEQLWVEAMERSLHPKAKYKKVRIIRLVGMMLVVFVKKIYKNLIKEVAAEHVGTGIMGKM
GNKGGVAVRFVFHNTSFCIVNSHLAAHVEDFERRNQDYKDICARMTFHLLDQPPLNIVKH
DVVIWLGDLNYRLCLYDAADVKFHISQNELKRLQEVDQLNIQRQTKKAFTDFMEGEINFM
PTYKYDPKTDRWDSSGKCRVPAWCDRILWRGNNVKQLKYRSHMELKTSDHKPVSALFSVG
VKVVNDPRYKKVFEEIVRAMDRMENDFLPSVTLDKREFAFANVKFRQLQRERFVITNDGQ
VPCHFAFIPKLNDSQYCKPWLRAEPSDGFLEPNETLEIYLDVYVSKDSVTLLNSGEDAIE
DILVLHLDRGKDYFITISGNYLPSCFGTSLETLCRMKKPIREIPITRLIDLEEDSYMEKE
KSKMSFLMVEGSGTEDKPLKIPKEVWILVNHLFTKSCDQEDLFQTPGLQDELQGIIDCLD
TSIPDSISGCNHSVAEALLIFLEALPEPVLCYELYHRCLECAHDSRLCKQLISQLPRAHR
NVFRYLMAFLKELLKHSHNNNLTASLIATLFASLLIRPPPNLMGKHTPHERQKAIDFILG
FLMAGDEE
Download sequence
Identical sequences G3PZB2
ENSGACP00000022952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]